KEGG   Bifidobacterium longum DJO10A: BLD_0786Help
Entry
BLD_0786          CDS       T00707                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLD_0786 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0786 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLD_0786 (thrC)
Enzymes [BR:blj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLD_0786 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904403..905893
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNKWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHETGTTAPAALRGLETADVRFKDVV
AIDDMEDYVEKAAQAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaccgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcagatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgatgagcgcatcaccccactcaagcccctgggtgacgattacgtg
ctcgaactgttcaacggtccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggaactgcagatg
accacgcaggccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgtgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcttacgcccagctgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagttcgtggtcccgaccggcaacttcggcgatatcctcgccggctactatgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgtctgatttccatgctgatgaacgacctcaacaagtggggcacgtacgag
atcccggaagaactgctggccaagattcgtcagatcttcggcaccggttgggccgatgag
gatcaggtacgcgagtccatcaaacactgctgggacgagaaccactacgtgatcgatccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtactgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggcattgggc
ttcgacgccaccggcaccgacttcgagtgcatggatgtgctggcccacgagaccggcacc
accgccccggccgccctgcgtggtcttgagaccgccgacgtgcggttcaaggacgtcgtg
gccatcgacgacatggaggactacgtggagaaggccgcccaggcgctgtga

DBGET integrated database retrieval system