KEGG   Bifidobacterium longum DJO10A: BLD_0844Help
Entry
BLD_0844          CDS       T00707                                 

Gene name
tdh1
Definition
threonine dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLD_0844 (tdh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_0844 (tdh1)
  Lipid metabolism
   00071 Fatty acid degradation
    BLD_0844 (tdh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLD_0844 (tdh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLD_0844 (tdh1)
   00626 Naphthalene degradation
    BLD_0844 (tdh1)
Enzymes [BR:blj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLD_0844 (tdh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(968185..969228)
Genome map
AA seq 347 aa AA seqDB search
MSETMKAAIFVEPGKMTVEEVPKAMLEQDDDIVIRVVRTCVCGSDLWFFRGLSGQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAVSAEVKPGDTAVVMGDGA
VGLCGVIAAKMRGATRVIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLEMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DEGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaccatgaaagctgcgattttcgtggagcctggcaagatgaccgtggaagaa
gtgccgaaggcgatgcttgaacaggatgatgacatcgtgatccgcgtggtgcgcacgtgc
gtgtgcggctctgatttgtggttcttccgtgggctgagcggacaggccgcacacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgtcaag
cccggcgatttcgtggttgtgccattcccatacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacggcggctacttctccgcctgtcaggccgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgagcagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggtttctgccgaggtcaagcccggtgacaccgccgtggtcatgggcgatggcgca
gttggcctgtgcggtgtgattgccgccaagatgcgcggtgccacgcgcgttattgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaattcggtgcgactgatatcgtgccc
gagcgtggccaagaggctattgacaaggtgctggagatgaccggcggctatggtgcggac
gcagttctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgattggtcgtgtgggcctgccgcacgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggctcccgtgcgccactatgacctt
gatgagggtctgctggacgcggtgctcaagggcgagatcaaccccggccgcgtgttcacc
gccgagtacgacctcgaccatatccaggacgcctacgaggcgatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system