KEGG   Bifidobacterium longum DJO10A: BLD_0926Help
Entry
BLD_0926          CDS       T00707                                 

Gene name
lacA1
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLD_0926 (lacA1)
Enzymes [BR:blj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLD_0926 (lacA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1067652..1069727)
Genome map
AA seq 691 aa AA seqDB search
MERKEFKWPQPLAGNEPRIWYGGDYNPDQWPEEVWDEDIELMQQAGVNLVSVAIFSWAKL
EPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHPEILWVDYRGDVCQPGA
RQHWRATSPVFLDYALNLCRKMAEHYKDNPYVVSWHVSNEYGCHNRFDYSEDAERAFQKW
CEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFMNPGKLLDWKRFSSDALLD
FYKAERDALLEIAPKPQTTNFMVSAGGTGIDYDKWGYDVDFVSNDHYFTPGEAHFDELAY
SASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVRDSLAHLAMGSDAICYFQWRQ
SKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADEGLLSTKLVKSKVAVVFDYESQ
WATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPVRGPWDEYEAVVLPSLTILSEET
TRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGSIRDVVGVRVEEFAPMGNDFPGAM
DHLDLDNGTVAHDFADVITSVADTAHVVASFKADKWTGFDGAPAITVNDFGDGKAAYVGA
RLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVERADETGENHFVFLFNRTHDVAVVDV
EGEPLVASLAQVNESEHTAAIQPNGVLVVKL
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtaaagagttcaagtggccgcagcctcttgcgggcaacgagccccgcatctgg
tacggcggcgactacaaccccgaccagtggccggaggaagtctgggacgaagacatcgag
cttatgcagcaggccggcgtcaacctcgtctccgtagccatcttctcctgggccaagctt
gagcccgaagaaggcgtgtacgacttcgattggctcgatcgcgtcatcgacaagctcggc
aaggccggcatcgccgtcgatctcgcctccggcaccgcatccccgccgatgtggatgacc
caggcccacccggagatcctctgggtcgactaccgcggcgacgtctgccagcccggtgcc
cgccagcactggcgcgccaccagcccggtcttccttgactacgcgctcaacctgtgccgc
aagatggccgagcactacaaggacaacccctatgtggtctcttggcatgtgagcaacgag
tacggctgccacaaccgcttcgactattccgaagacgccgagcgcgccttccagaagtgg
tgcgagaagaagtacggcaccatcgatgccgtcaacgacgcctggggcaccgccttctgg
gcgcagcgcatgaacaatttctccgagatcatcccgccgcgcttcatcggcgatggcaac
ttcatgaatccgggcaaactgcttgactggaagcgcttcagctccgacgccctgctcgac
ttttacaaggccgagcgcgatgccctgctcgagatcgcccccaagccgcagaccaccaac
ttcatggtctccgccggcggtaccggcatcgattacgacaagtggggttacgacgtggac
ttcgtgtccaacgatcactacttcacgcctggcgaagcccacttcgacgagctggcttac
tcggcctccctatgtgacggcatcgcccgcaagaatccgtggttcctcatggagcactcc
agctccgccgtcaattggcgcccgatcaactatcgcgtcgagcccggcgaattggtgcgc
gactccctggcccacttggccatgggctccgacgccatctgctacttccagtggcgccag
tccaaggccggtgccgagaagtggcactcttcgatggttcctcacgcgggccccgactcc
cagatcttccgcgatgtgtgcgagctgggtgccgacctcaacaagcttgctgacgagggc
ctgctgagcaccaagctggtcaagtccaaggtcgccgtcgtcttcgattacgagtcccag
tgggctacggaacacaccgccacgcctactcaggaggtacgccattggaccgagccgctc
gcgtggttccgcgcgctggcggacaacggtctgaccgcagacgtggtgccggttcgcggc
ccttgggacgagtacgaagccgtcgtgctgccgagcctgaccatcctgtccgaagagacc
acgcgccgcgtgcgcgagtatgtggcgaacggcggcaagctgttcgtgacctactacacc
ggtctggtggacgacaaggatcacgtctggctgggtggctaccccggttccatccgtgac
gtggtgggtgtgcgcgttgaggaattcgccccgatgggcaacgacttccccggtgccatg
gaccaccttgacttggacaacggaaccgtggcgcacgatttcgccgacgtgatcacctcc
gtggccgataccgctcacgtggtcgcctccttcaaggcagataagtggaccggtttcgac
ggcgctcccgccatcaccgtcaacgacttcggcgacggcaaggccgcatacgtcggtgcc
cgtctcggccgtgagggtttggccaagagcctgcccgtgctgctggaggaactcggcatc
gagacttcggctgaggacgatcgcggtgaagtgctgcgcgtcgagcgtgcggacgaaact
ggcgagaaccacttcgtgttcctgttcaaccgcacccacgatgttgcggtcgtggacgtg
gaaggcgaaccgctggtcgcctcgctggcccaggtcaacgagtccgagcacacggccgcc
atccagcccaacggcgtactcgtcgtcaagctgtaa

DBGET integrated database retrieval system