KEGG   Bifidobacterium longum DJO10A: BLD_1005Help
Entry
BLD_1005          CDS       T00707                                 

Gene name
lacA2
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blj00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1179123..1181255)
Genome map
AA seq 710 aa AA seqDB search
MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGEAGVNVVSLAIFSWDK
IEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESHPEVLPVDRYGHTVNAG
SRQSWQPTSPVFKEYALRLCRRLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAMVNPSQQLDYERFGNDMLL
DFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAICFFQW
RQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLSDAGLQGTELERAGTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVVPLAYDWTGYKTIVLPTVLSLSD
EDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLASYAGKSAADWELERTPAITSRPYGN
GTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTESGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAINGVEGDPIIAHRCETDAVGYTLNRNAILIAKTSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcatagagcatttaggtggccgtccctgctgacggaatccggccgcggcatc
gcgttcggcggcgactacaacccggaccagtggcccgaggagacgctggacgaggatatc
cgtctcatgggtgaggccggcgtgaacgtcgtatcgctggcaattttcagctgggacaag
atcgagccggtcgagggcgcgttcacgttcgagtggctcgaccatgtgatcgacaggctc
ggcagagccggcatcgccgtggacttggcctccgccacagccgccgcgccgctgtggctg
tacgaatcccatccagaggtgctgccggtagaccggtatggtcataccgtcaacgcgggc
tcacgccagtcgtggcagccaacaagcccggtgttcaaggaatacgcgctgcgcctgtgc
cgcagacttgccgaacactacaaggacaacccgtatgtgaccgcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaagtacggtaccatcgacgcgttgaacgaggcgtggggcacggccttc
tggtcgcagcacgtgaacagtttcgacgaggtgctgctgccacgtcacatgggcggcgac
gccatggtcaacccgtcgcagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaagccgaacgcgacgccatcgagcagatctgccccgacaagccgttcacc
acgaacttcatggtctccaccgaccagtgcgtcatgaactacgccaaatgggcggatgag
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccacctggacgaactc
gcctgctcggacgcgctcatggactccctcgcgctgggcaagccgtggtacgtgatggag
cactccacctcagccgtgcagtggaagccgctgaacacacgcaaacgggccggcgaactc
atgcgcgactccctggcccacgtggccatgggcgccgacgccatctgctttttccaatgg
cggcaatccaagtcgggcgccgaggcgttccactccgccatgctgccccacgcgggtgcc
gattccaaggtcttccgcggcgtatgcgagctcggtaaggcgctgaagaccctctccgac
gccgggctgcagggcactgagctcgagcgtgccggcacggcgatcctgttcagcgcggaa
tccgaatgggccacacgctccgaaaccctgcccagcatgaaactcaaccactggcacgac
gtgcgcgactggtaccgcggcttcctggatgccgggctgcgcgcggacgtggtgccgctc
gcctacgactggaccggctacaaaaccatcgtgctgcccaccgtgctcagcctgtccgac
gaagacgttctccgtatcgccgacttcgcgaaggccggcggaaccgtcatcgtcggctat
gccgccggcctgatcgacgagcacttccacatcggcctcggcggctaccccggcgccggc
aacgggctcctacgcgacatgctcggcatccgctccgaagaattcaacatcctcggtgaa
gaagccgaaggcgagcccagcgaaatcagcctgtccaatggtctgacgacccgcctgtgg
cagaacgacgtgacttccgtagccgcggacaccacagtgcttgcctcttacgcaggtaag
tccgccgccgactgggagctggagcgcacccccgccatcaccagccgcccctatggcaac
ggtaccgccatctacgtgggctgcgacctcaaccgtcacgacattgcccagttgctcaaa
gcacttggctcccgatggcaggagttgtcggcgcagccgactgagagtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagacggctcc
acccgcttcgatttctacctcaaccgctcaaaccagcccgtcgccatcaacggtgtggaa
ggtgatcccatcatcgcccaccgttgcgagactgacgccgttggatatacgctgaaccgc
aacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system