KEGG   Bifidobacterium longum DJO10A: BLD_1331Help
Entry
BLD_1331          CDS       T00707                                 

Gene name
treY
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLD_1331 (treY)
Enzymes [BR:blj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BLD_1331 (treY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1538532..1540058)
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYNLGGKTRLVWVSFTPQQVDIDTDSAKGWEYLMSIFDQ
MAASHVRYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVAHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRRTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFDGEFSYEVDGDTSITFRWTAADGTSTAALTFEPGRGLGTDNATP
VASLAWSDAAGDHETRDLLANPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcaactcatcacatacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccataccaaa
gtcgacgaacgtctcggcagctgggacgacgtcgccgaactctccaagacccacaacatc
atggtcgacgccatcgtcaaccacatgagttgggaatccaagcagttccaagatgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtgttcccg
aacggcgccaccgaagaagacctggccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaacctcggcggcaagacccgtttggtatgggtcagcttcaccccgcagcag
gtggacatcgacactgattccgccaagggttgggaatacctgatgtcgatcttcgatcag
atggccgccagccacgtgcgctacatccgtctcgacgccgtgggctacggcgccaaggaa
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcccgtctgcgcgag
gagggcgtcaagcgcggccttgaaatcctcatcgaggttcacagctactacaagaagcag
gtggaaatcgcctccaaggtggaccgcgtctacgatttcgccctgccgccgctgcttctg
cactcgctgttcaccggtcacgtcgaacccgtggcccactggaccgagatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgatggcatcggcgtgatcgacatcggctccgac
cagctcgaccgctccctcaagggcctcgtgcccgacgaggacgtcgacaacctggtcaac
accatccatgccaacacccacggcgaatcccaggccgccaccggtgccgccgcgtccaac
ctcgacctctaccaggtcaactccacgtactactcggccctcggctgcaacgaccagcac
tacttggccgcccgcgccgtgcagttcttcctgccgggcgtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgccgcaccaacaacggccgcgac
atcaaccgccactactactccaccgccgaaatcgatgaaaacctcgaacgcccggtggtc
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcgatggcgagttc
agctacgaggtcgatggcgacacgtccatcaccttccgctggaccgccgccgacggcacg
tccacggccgccctcaccttcgagcccggacgcggcctcggcacagacaacgccaccccg
gttgccagccttgcctggagcgatgccgccggcgaccacgaaacccgcgatctgctcgcc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system