KEGG   Bifidobacterium longum DJO10A: BLD_1375Help
Entry
BLD_1375          CDS       T00707                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:blj00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590165..1591256)
Genome map
AA seq 363 aa AA seqDB search
MQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAGIEPLSGIMDTGGRSGQLH
YLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEHRGH
GKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAVLER
YPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGKKRVFGQSGFTPEFSMEGNEG
ASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRAILNPSACAEVETPVLLFQSGRD
IWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPMIAC
AAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgaccgacgtggtgctg
cccgcgctcgaacaatgctgcgaggagggctggttcgatccgtccgccgccgaacgttcg
gccgggatcgagccgctgtccggcattatggacaccggcggccgctcgggccagctgcac
tacctgtgctacgactccgccaaattcgacgcgattcgcgagcaaggcgccaccgccacc
ttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgaaaagtacgacgag
ctcgtctggtacttcctgcttgccggctactcggtgtgtgtactcgagcatcgcggccac
ggcaagtccgcgcgcgacgtggacaaccgctgcatggtgtggattgatgactggcagcgc
tacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcggccggcatg
ccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccgtgttggagcga
taccccaccctgttcgacaaagcggtgctctctgccccgatgatcgcccccgccaccggc
atgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggcttcggcaag
aagcgcgtgttcgggcagtcgggcttcacgccggaattctcgatggaaggcaacgagggc
gcttccgaagcgcgtgaacgctggtacttcaagctgcgttgcgagaatagcgaataccag
acctactgcgcggcgttcgaatgggtgcgccaagcgttgaagctcaaccgggccatactg
aatccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtccggacgcgac
atctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggacggcggcggc
gaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatgcccaacagc
acttacaagccctacctcgaaaagatcctcggcttctacgacgaccccatgattgcctgc
gccgcgtactga

DBGET integrated database retrieval system