KEGG   Bifidobacterium longum DJO10A: BLD_1451Help
Entry
BLD_1451          CDS       T00707                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00900  Terpenoid backbone biosynthesis
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BLD_1451 (ispE)
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BLD_1451 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACD98896
UniProt: B3DP37
Position
complement(1684789..1685739)
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRSAAARHQSDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTTYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDIVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIEVWRDTAVVDR
IIRAKSPEHPNISVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgctcagccgctgcccgacatcagtccgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtggga
cctgctcacgacgaatggggcggacgccacgaactggacaccacctactgtgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcgggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcccatagagcgcctgcgcacc
attgccgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcataccagtcgcaactcagcact
cctgaggtctaccacacctttgacatcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgaggtgtggcgcgatacagctgtggtcgatcgt
attattcgagccaaatctcccgaacaccccaatatcagcgtcagacagtga

DBGET integrated database retrieval system