KEGG   Bifidobacterium longum DJO10A: BLD_1483Help
Entry
BLD_1483          CDS       T00707                                 

Gene name
galA1
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:blj00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:blj00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:blj00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1732081..1734387
Genome map
AA seq 768 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPRIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTVWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIETGGVLE
ATLDAVSGESYTDVAGHARATGPARVPGVIVTARDEEQGVEVEWHLELLPGGLVRQKATV
TNLFGADAGAQLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFGFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFGTLKALADRAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHPGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLLKAVALS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctcgactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcgcatcgtccactggggtcgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgtctggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcagcgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaacatcgagaccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgcgcc
accggcccggcccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgaatggcacctcgaactgctccccggcggcctggtccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagcccagctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagcccgcagcgccaaccgctgaccgtcggccgtttcgaaaagccgcagctcgccggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcggcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtactgtccgccgaa
cgtctgccctacacaaccggcgtgatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgccggccccggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggcctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacgtgggaagccgtgtacttc
gaccacaacttcggtacgctgaaggcactcgccgacagggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggttcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggcccgaagtccctgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccctgattggattctctcgcccaccgctggccga
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgactacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgcccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcgcatccgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctggagcacgcc
gatcgtatctgggtctccgactgcgtggacccggttgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagccccgcacac
tccacccagcgcgccaccagccaggaactgcgcatggccatggcgttcttcggccacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgtgtgcacgccgac
tccaacgatccggccgtgcgtctggacggtatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccaccagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggcgtagtcctgacc
ggcgaagccctgcagcgctacggcattcgtcctccgtccctccacccccagcaggcagta
ttgctcaaggctgtggcgttaagctga

DBGET integrated database retrieval system