KEGG   Bifidobacterium longum DJO10A: BLD_1569Help
Entry
BLD_1569          CDS       T00707                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:blj00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:blj00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1867579..1869030
Genome map
AA seq 483 aa AA seqDB search
MAFEFEKELKVEKTNIPGLLVFDLPVHGDNRGWFKENWQRAKMMGLGLPDFGPVQNNISY
NATKGVTRGIHAEPWDKYISIAAGEIFGAWVDLRPGESFGQVYTTRLDPSKAIYVPRGVG
NSFQALQDGTVYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPIPLEESERSEADLHHPM
LKDAKPMAPKRTLVTGCNGQLGHAIRAYAEAHGLEGFEYTDIDEFDFSDPKAYEAYDWSL
YGTIINAGAYTAVDKAETAEGRPIAWKANAQGPALLAKVAKDHHITLVHVSSDYVFDGTA
KEHTETEAFAPLGVYGQTKAAGDIAVANAPEHYILRSSWVIGEGHNFVKTMMMLSNKVAD
PADKLEQVTVVDDQYGRLTFTRDMAEAIFHLLDSHAPYGTYNLTGSGAVKSWADIAAEVF
DLTNGNGSKVKPISTAEYFANATNPVSPRPVNSALDLAKIGEAGYVPADWEETLKTYVQK
ELG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattcgagaaggaactgaaggtcgagaagacgaacatcccgggccttctg
gtgttcgacctgccggtgcatggcgacaaccgtggctggttcaaggagaactggcagcgc
gccaagatgatgggtctgggactgccggacttcggcccggtgcagaacaacatcagctac
aacgcgaccaagggcgtcacccgtggcatccacgcggagccgtgggacaagtacatcagc
atcgctgccggcgagatcttcggcgcgtgggttgacctgcgcccgggcgagagcttcggc
caggtgtacacgacccgtttggatccgtccaaggcaatctacgtgcctcgcggcgtgggc
aacagcttccaggcgctgcaggacggcacggtgtacacgtatctggtgaacgcgcactgg
tcgctcgagcagaagaagacctacacgttcgtgaaccttgcggatccggaactgaacatc
cagtggccgattccgctggaggagtccgagcgctccgaggccgatctgcaccacccgatg
ctcaaggacgccaagcccatggctcccaagcgcaccctggtgacgggctgcaacggccag
ctgggccacgcgattcgcgcctacgcggaagcgcatggtctggagggcttcgagtacacg
gacatcgacgagttcgacttctccgacccgaaggcatacgaggcatacgattggagcctg
tacggcacgatcatcaacgccggtgcctacacggccgtcgacaaggccgagaccgccgaa
ggccgtccgatcgcgtggaaggcgaacgcccagggtccggctctgctggccaaggtggcc
aaggaccaccacatcaccctcgtgcacgtgagttcggattatgtgttcgacggcaccgcc
aaggaacacacggagacggaggcgttcgccccgctcggtgtgtacggccagaccaaggcc
gctggcgacatcgccgtggccaacgcacccgagcattacatcctgcgttccagctgggtg
atcggcgaggggcacaacttcgtgaagaccatgatgatgctgtccaacaaggtcgccgac
ccggccgacaagctggaacaggtcaccgtggtggatgaccagtacggtcgcctgaccttc
acccgcgacatggccgaggcgatcttccacctgcttgacagccatgccccctacggcacc
tacaacttgaccggttccggcgcagtgaagtcctgggctgacatcgcggccgaggtgttc
gacctgacgaacggcaacggcagcaaggtcaagcccatcagcactgccgagtacttcgcg
aacgcgaccaacccggtatctccgcgtccggtcaactccgcactggatcttgctaagatc
ggtgaagccggatacgtgcccgctgactgggaagagaccctcaagacctacgtgcagaag
gaactcggctga

DBGET integrated database retrieval system