KEGG   Bifidobacterium longum DJO10A: BLD_1569Help
Entry
BLD_1569          CDS       T00707                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BLD_1569 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLD_1569 (rfbC)
Enzymes [BR:blj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     BLD_1569 (rfbC)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BLD_1569 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1867579..1869030
Genome map
AA seq 483 aa AA seqDB search
MAFEFEKELKVEKTNIPGLLVFDLPVHGDNRGWFKENWQRAKMMGLGLPDFGPVQNNISY
NATKGVTRGIHAEPWDKYISIAAGEIFGAWVDLRPGESFGQVYTTRLDPSKAIYVPRGVG
NSFQALQDGTVYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPIPLEESERSEADLHHPM
LKDAKPMAPKRTLVTGCNGQLGHAIRAYAEAHGLEGFEYTDIDEFDFSDPKAYEAYDWSL
YGTIINAGAYTAVDKAETAEGRPIAWKANAQGPALLAKVAKDHHITLVHVSSDYVFDGTA
KEHTETEAFAPLGVYGQTKAAGDIAVANAPEHYILRSSWVIGEGHNFVKTMMMLSNKVAD
PADKLEQVTVVDDQYGRLTFTRDMAEAIFHLLDSHAPYGTYNLTGSGAVKSWADIAAEVF
DLTNGNGSKVKPISTAEYFANATNPVSPRPVNSALDLAKIGEAGYVPADWEETLKTYVQK
ELG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattcgagaaggaactgaaggtcgagaagacgaacatcccgggccttctg
gtgttcgacctgccggtgcatggcgacaaccgtggctggttcaaggagaactggcagcgc
gccaagatgatgggtctgggactgccggacttcggcccggtgcagaacaacatcagctac
aacgcgaccaagggcgtcacccgtggcatccacgcggagccgtgggacaagtacatcagc
atcgctgccggcgagatcttcggcgcgtgggttgacctgcgcccgggcgagagcttcggc
caggtgtacacgacccgtttggatccgtccaaggcaatctacgtgcctcgcggcgtgggc
aacagcttccaggcgctgcaggacggcacggtgtacacgtatctggtgaacgcgcactgg
tcgctcgagcagaagaagacctacacgttcgtgaaccttgcggatccggaactgaacatc
cagtggccgattccgctggaggagtccgagcgctccgaggccgatctgcaccacccgatg
ctcaaggacgccaagcccatggctcccaagcgcaccctggtgacgggctgcaacggccag
ctgggccacgcgattcgcgcctacgcggaagcgcatggtctggagggcttcgagtacacg
gacatcgacgagttcgacttctccgacccgaaggcatacgaggcatacgattggagcctg
tacggcacgatcatcaacgccggtgcctacacggccgtcgacaaggccgagaccgccgaa
ggccgtccgatcgcgtggaaggcgaacgcccagggtccggctctgctggccaaggtggcc
aaggaccaccacatcaccctcgtgcacgtgagttcggattatgtgttcgacggcaccgcc
aaggaacacacggagacggaggcgttcgccccgctcggtgtgtacggccagaccaaggcc
gctggcgacatcgccgtggccaacgcacccgagcattacatcctgcgttccagctgggtg
atcggcgaggggcacaacttcgtgaagaccatgatgatgctgtccaacaaggtcgccgac
ccggccgacaagctggaacaggtcaccgtggtggatgaccagtacggtcgcctgaccttc
acccgcgacatggccgaggcgatcttccacctgcttgacagccatgccccctacggcacc
tacaacttgaccggttccggcgcagtgaagtcctgggctgacatcgcggccgaggtgttc
gacctgacgaacggcaacggcagcaaggtcaagcccatcagcactgccgagtacttcgcg
aacgcgaccaacccggtatctccgcgtccggtcaactccgcactggatcttgctaagatc
ggtgaagccggatacgtgcccgctgactgggaagagaccctcaagacctacgtgcagaag
gaactcggctga

DBGET integrated database retrieval system