KEGG   Bifidobacterium longum DJO10A: BLD_1614Help
Entry
BLD_1614          CDS       T00707                                 

Gene name
argE2
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLD_1614 (argE2)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLD_1614 (argE2)
Enzymes [BR:blj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLD_1614 (argE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928956..1930161
Genome map
AA seq 401 aa AA seqDB search
MTLELNRTASTAEQLNSLLTQIMENFSVSDHEGPLTDEVEAFLNEQEHLTVRRHGDTVVA
STDFGKPSRVILAGHLDTVPVIDNFPPKWLEPGDSLIREEIAHAHPEDRVLWGRGATDMK
ASDAVMLYLAATLDGRTPETTPKVDLTYVFYDHEEVVAEKNGLRKVVEAHPDWITGDFAI
IGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGENAIHKAADILSRLNAYEPATVNV
DGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADAGAELGNG
EHVATGGVFEGYGIEMKDESPSARPGLNAPLAQDLVRLVKERTGRDPLAKLGWTDVARFS
QLGIPAVNLGAGDPLLAHKHDEQVPESDLTVMAAILTDWLV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagcctgctcacc
cagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgacgaggtcgag
gccttccttaacgagcaagagcacctgaccgtccgccgtcacggcgacacagtggtggcc
agcaccgacttcggcaagccgagccgtgtgatcttggccgggcacctcgatactgtgccg
gtcatcgacaatttcccaccaaagtggctggagcccggcgattcgctgattcgcgaagaa
atcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccaccgatatgaag
gcctccgacgcggtgatgctctacctcgccgccacgctcgacggccgcacgccggaaacc
accccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtcgccgaaaag
aacggcctacgcaaagtcgtcgaggcccatcccgattggatcaccggcgatttcgccatc
atcggcgagcccaccaacagcggcatcgagggcggttgcaacggtacgattcgcttcgac
gtcgtaacccacggcgtggccgcgcactccgcccgcgcgtggatgggggagaacgccatc
cacaaggcggccgacatcctgagccgactcaacgcttacgagccggccaccgtgaacgtg
gacgggctcgactatcgcgagggcctcaacgccacgctgatctccggcggcaagggtacg
aacgtcattccggatgaatgccgcgtacacgtcaactaccgcttcgccccggacaagtcg
ctggccgaggccaaggccctgatgatgggcgcggatgccggtgccgaactcggcaatggc
gagcatgtggccactggcggcgtgttcgagggctacggcatcgaaatgaaggacgaaagc
ccctccgcgcgcccgggcctgaacgccccgctcgcccaggatctggtccgactggtcaag
gagcgcaccggccgcgacccgttggccaagctcggctggaccgacgtggcacgcttctcc
cagctcggtatcccggccgtcaacctcggtgccggcgacccgctgctggcgcacaagcac
gacgagcaggtgcccgaatccgacctgaccgtcatggccgcaattcttaccgactggctg
gtctga

DBGET integrated database retrieval system