KEGG   Bifidobacterium longum DJO10A: BLD_1704Help
Entry
BLD_1704          CDS       T00707                                 

Gene name
putA2
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLD_1704 (putA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_1704 (putA2)
   00620 Pyruvate metabolism
    BLD_1704 (putA2)
   00650 Butanoate metabolism
    BLD_1704 (putA2)
  Lipid metabolism
   00071 Fatty acid degradation
    BLD_1704 (putA2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLD_1704 (putA2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLD_1704 (putA2)
   00626 Naphthalene degradation
    BLD_1704 (putA2)
Enzymes [BR:blj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLD_1704 (putA2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLD_1704 (putA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2049657..2052386
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVARAKKALVEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMQHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDS
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSAVPGKSPQFIAKAAGFEIPADATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTNA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgaccccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgtcgaattc
gagaacctcgaccagaagcaagttgatcgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgtgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgtgaagacgacgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggtgtcaccccggttaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacccgttgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagattgtgcgcgacgccgccatcgaggccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccaccggcgcgctgatgcag
cacccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctatgttgattcc
gatgtggacatcgtgcgtgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcactgccggttccggcgtcaagcccgtgctgaactccgcggtg
ccgggcaagtcccctcagttcatcgccaaggctgctggcttcgagattccggccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagccgctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tccctcggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgtcgacaagatcatcgaccagctgcgc
gcccgctctaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagattatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctggtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaatggcgagcccggcctggccaagaccaacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgtgacaacaagctcggcatgaacaagagcttccaggattgcggtgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgtaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggtgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgttga

DBGET integrated database retrieval system