KEGG   Bifidobacterium longum DJO10A: BLD_1779Help
Entry
BLD_1779          CDS       T00707                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLD_1779 (gpmA)
   01230 Biosynthesis of amino acids
    BLD_1779 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_1779 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BLD_1779 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_1779 (gpmA)
Enzymes [BR:blj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLD_1779 (gpmA)
Exosome [BR:blj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLD_1779 (gpmA)
  Exosomal proteins of melanoma cells
   BLD_1779 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2129163..2129903
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaactagtactgctccgtcatggacagagcgcatggaataaaactaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacatcgtgttcacctccctgctgcgt
cgcgccatcaacaccgccaacatcgctctggatgccgcagatcgtctgtggattccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgacgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctacgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggcaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctctacgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgccgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system