KEGG   Bifidobacterium longum DJO10A: BLD_1852Help
Entry
BLD_1852          CDS       T00707                                 

Gene name
folB
Definition
dihydroneopterin aldolase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLD_1852 (folB)
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BLD_1852 (folB)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     BLD_1852 (folB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205571..2206983
Genome map
AA seq 470 aa AA seqDB search
MDTITLTGVHANGTHGVLAFEHERPQTFVVDVTLHLDLAAAGQSDDLNDTIDYGRVAKDI
VAVIEGPHVDLIERLAQRIADKILADAPAVASIDVTVHKPHAPIVVAFADVSVSISRVRA
TDNGRTAEKHAIHNAVVALGGNVGEVESTLRAAVREIDALLGTQVTGISPLYRTAAWGMA
DGTPDFLNAVVELETTMGSHELLAALQNIEANHGRIRENHWDSRPLDLDIIDFDGITSAD
PDLALPHPRAWQRAFVLAPWAALNPNAKLAGAHEGPVADLLAAAPDRNAVQLESEDWMLG
GHAVKQESASESEPVSRKAIISLDSTSQDAERLFRETIVSIDSVPGNQVQGISPLYHVSH
FDSPDAMSAVIQIETKLPPADLIAVLGSIESVHDLAVDLDLVDMEGVTSDEPNCSIPWPS
ARNHASVLAPWLDMDPNASLGGDPVAFLLAMAPDAGQVGLLSDNWILSNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcacacttaccggcgtacatgccaacggcacccacggtgtgctcgccttt
gaacacgaacggccacaaaccttcgtcgtggacgtcaccctgcaccttgatctggccgcc
gccggccaatccgacgatctcaatgacaccatcgattacggccgcgtggccaaggatatc
gtggctgtcatcgaaggccctcatgtggacctgatcgagcgtctggcccaacgtatcgcg
gataagattcttgccgatgcgccggccgtcgcctccatcgacgtcaccgtgcacaagcct
cacgcgcccatcgtcgtggcttttgcagatgtatcggtctccatctcgcgcgtgcgtgcc
accgataatggacgcactgctgaaaagcatgccatccataacgcggtggtggccttgggg
ggcaatgtgggcgaggtggaatccaccttgcgagccgccgttcgggagattgacgcgctg
cttggcacacaggtgaccggtatttcgccgctttaccgcacggccgcgtggggcatggct
gacggtacgccggatttcctgaacgccgtggtggagcttgaaaccacaatgggcagccac
gaattgctcgccgcgttgcaaaacatcgaagcgaaccatgggcgaattcgtgagaatcat
tgggattccaggccgttggacttggacattatcgactttgatggcatcaccagcgcggat
ccggatctggcattgccccatccgcgtgcttggcagcgcgcatttgtgctggctccctgg
gcggcgctgaatccgaacgccaaacttgccggagcccatgaggggcctgtagccgatttg
ctggccgccgcgccggaccgtaacgccgtgcagctcgagagcgaagactggatgctcggc
gggcatgcagtcaagcaagaatcagcgtcggagtcggaacccgtctcacgcaaggcgatt
atttcgctggattccacctcgcaggatgccgaacggctgttccgcgaaaccatcgtttcc
atcgacagtgttcctggcaatcaggtacagggcatctcgccgctctaccatgtcagccat
ttcgacagtccggacgcgatgagcgcggtcatccaaatcgaaaccaagttgccgcccgcc
gacctgattgccgtattgggcagcatcgaaagcgttcatgacctggcagtcgaccttgac
cttgttgacatggaaggcgtgacttccgacgagcccaactgcagcattccttggccgtcg
gcccgtaaccatgcgtcggtattggcaccttggctggatatggacccgaatgcttctctg
ggcggcgacccggtggccttccttttggccatggcaccggatgccggacaggtcggattg
ctatcggacaactggatactgtcgaacagttga

DBGET integrated database retrieval system