KEGG   Bifidobacterium longum DJO10A: BLD_1856Help
Entry
BLD_1856          CDS       T00707                                 

Definition
NagC family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLD_1856
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_1856
   00052 Galactose metabolism
    BLD_1856
   00500 Starch and sucrose metabolism
    BLD_1856
   00520 Amino sugar and nucleotide sugar metabolism
    BLD_1856
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLD_1856
   00524 Butirosin and neomycin biosynthesis
    BLD_1856
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLD_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2211421..2212371
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLMELCGGDIAKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaactaagatcgccgccgccgtctgcgatgaa
aacgatagcatcatccagcgctggcgcgtccccacgccgatggatgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccggacacaccgatatcgaggcc
atcggcatctccgctgccggcaacgtgagcgccgaccgcaagacgctcaccttctccgcc
aacatcccggcctggatcaactacgacctgtccgagcacgtcggcgcgctgatcgaccat
gctgtgccggtcgttgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgccggccagggcagctccaacatggtcgccctgaccgtgggcaccggcctcggcggc
gccatcgtgatcaacggtcagctgtaccgcggctccttcggcatggccgccgaactcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgag
cgctacacctcgggcacttcgctggagaacttcgccaagtccgccgtgcgccgtcgtccg
caggatgccaagcgtctcatggagctgtgtggcggcgacatcgccaagctggaaggcccg
atggtctcccaggccgcccaggaaggcgacgtgctcggcctgtacgcattcggcaagatc
ggcgaatggcttggccgcacgatggccgcagtctccgccgtgctcgatccggacctgttt
gtgatcggcggcggtgtggtggccgtcggcgacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgccgccacc
gccggccaagacgccggcctcatcggtgccgccaacctggctctgcgctga

DBGET integrated database retrieval system