KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00145Help
Entry
BLNIAS_00145      CDS       T01845                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLNIAS_00145
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BLNIAS_00145
Enzymes [BR:blk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BLNIAS_00145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131342..132667
Genome map
AA seq 441 aa AA seqDB search
MAENPDDVLHVEGGKPLNGTIKVRGAKNFVSKAMVAALLAPGKSVLKNVPEIRDVHVVSD
LLRLHGVDVDVDGANGIVTIDASRVQLADVADVDTLSGSSRIPILFSGPLVHRLGEAFIP
ALGGCAIGGRPIDFHLETLRKLGATVDKEHKDGIHITAPNGLHGAKIHLPYPSVGATEQT
LLAAVLAEGKTELSGAATEPEIMDLVCVLQKMGAIISVDVDRTFRIEGVKELQGYTHTSL
TDRIEAASWASAALATHGDIFVKGATQPEMITFLNVFRKVGGKFEVTDKGIRFWHPGGDL
KPVAIETDVHPGFMTDWQQPLVVALTQANGLSIVHETVYENRFGFTKPLVEMGATIQLYR
ECLGSLPCRFRQRNYKHSAVIFGPTPLTGRDIDVPDLRGGFSHLIAALAASGPSDVHGIS
LIDRGYADFRGKLEALGADFD
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaatccggatgacgtgttgcatgtcgagggcggcaagcctttgaatggcacg
atcaaggtgcgtggcgcgaagaacttcgtgagcaaggcgatggtcgccgcgttgctggca
ccgggcaagtcggtgctgaagaacgtgccggagattcgtgacgtgcatgtggtgtccgat
ttgctacgtctgcacggcgtggacgtggatgtggacggtgcgaacggcattgtgaccatc
gacgcctcgcgtgtgcagctggccgatgtggccgacgtggatacactgtccggttcgtcg
cgcatcccgatcctgttttccggcccgctcgtgcaccgtttgggtgaagcgttcattccc
gcgttgggcggctgcgcgattggcggacgtccgattgacttccatctggagacgctgcgc
aagctgggcgccacggtggacaaggaacacaaggacggcatccacatcaccgcgcccaac
ggcctgcacggcgcgaagatccacctgccctacccgtcggtgggcgccaccgagcagact
ttactggcggccgtgctggccgagggcaagaccgaactgtcgggcgcggccactgagccg
gagatcatggatctggtgtgcgtgctgcagaagatgggtgcaatcatttctgtggacgtt
gatcgcaccttccgcatcgagggtgtcaaggaactgcaggggtacacgcacacgtcgctg
acggatcgcatcgaggcggcgtcctgggcgtccgccgcgctcgccacgcacggtgacatt
ttcgtcaagggtgccacccagccggagatgatcacgttcctcaacgtgttccgcaaggtg
ggcggcaaattcgaggtgacggacaagggcattcgtttctggcatccgggcggggacttg
aagcccgtggcgatcgagacggacgtgcatcccgggttcatgaccgactggcagcagccg
ctcgtggtggccctgacccaggccaacggcctgtcgatcgtgcacgagaccgtgtacgag
aaccgtttcggcttcaccaagccgctggtcgagatgggtgccaccatccagttgtaccgc
gagtgcctgggctcgctgccgtgccgtttccggcagcgcaactacaagcattccgccgtg
atcttcggaccgaccccgctgaccggacgcgacatcgacgtgccggacctgcgtggtggg
ttcagccatctgatcgcggccttggccgcgtcaggcccctcggacgtgcacggcatcagc
ctgatcgaccgaggctacgccgacttccgcggcaaactcgaagcgttgggtgccgacttc
gattaa

DBGET integrated database retrieval system