KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00171Help
Entry
BLNIAS_00171      CDS       T01845                                 

Gene name
argE2
Definition
arge2
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLNIAS_00171 (argE2)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLNIAS_00171 (argE2)
Enzymes [BR:blk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLNIAS_00171 (argE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
150300..151505
Genome map
AA seq 401 aa AA seqDB search
MTLELNRTASTAEQLNSLLTQIMENFSVSDHEGPLTDEVEAFLNEQEHLTVRRHGDTVVA
STDFGKPSRVILAGHLDTVPVIDNFPPKWLEPGDSLIREEIAHAHPEDRVLWGRGATDMK
ASDAVMLYLAATLDGRTPETTPKVDLTYVFYDHEEVVAEKNGLRKVVEAHPDWITGDFAI
IGEPTNSGIEGGCNGTIRFDVVTHGVAAHSARAWMGENAIHKAADILNRLNAYEPATVNV
DGLDYREGLNATLISGGKGTNVIPDECRVHVNYRFAPDKSLAEAKALMMGADAGAELGNG
EHVATGGVFEGYGIVMKDESPSARPGLNAPLAQDLVRLVKERTGRDPLAKLGWTDVARFS
QLGIPAVNLGAGDPLLAHKHDEQVPESDLTAMAAILTDWLV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgaattgaaccgcaccgcatccactgccgagcagctgaacagcctgctcacc
cagatcatggagaacttctccgtgtccgaccacgagggccccctcaccgacgaggtcgag
gccttccttaacgagcaagagcacctgaccgtccgccgtcacggcgacacagtggtggcc
agcaccgacttcggcaagccgagccgtgtgatcttggccgggcacctcgatactgtgccg
gtcatcgacaatttcccaccaaagtggctggagcccggcgattcgctgattcgcgaagaa
atcgcccacgctcatcccgaagaccgcgtgctgtggggccgcggtgccaccgatatgaag
gcctccgacgcggtgatgctctacctcgccgccacgctcgacggccgcacgccggagacc
accccgaaagtcgacctcacctacgtcttctacgaccatgaggaagtcgtcgccgaaaag
aatggcctacgcaaagtcgtcgaggcccatcccgattggatcaccggcgatttcgccatc
atcggcgagcccaccaacagcggcatcgagggcggttgcaacggtacgattcgcttcgac
gtcgtaacccacggcgtggccgcgcactccgcccgtgcatggatgggggagaacgccatc
cacaaggcggccgacattctgaaccgactcaacgcctacgagccggccaccgtgaacgtg
gacgggctcgactatcgcgagggcctcaacgccacgctgatctccggcggcaaaggcacg
aacgtcattccggatgaatgccgcgtgcacgtcaactaccgcttcgcaccggacaagtcg
ttggccgaggccaaggctctgatgatgggcgcggacgccggtgccgaactcggcaatggc
gagcatgtggccactggcggcgtgttcgagggctacggcatcgtaatgaaggacgaaagc
ccctccgcgcgcccgggcctgaacgccccgctcgcccaggatctggtccggctggttaag
gagcgcactggccgcgacccgctggccaagctcggctggaccgacgtggcacgcttctct
cagctcggtatcccggccgtcaacctcggtgccggcgatccgctgctggctcacaagcac
gacgagcaggtgcctgaatccgacctgaccgccatggccgcaatccttaccgactggctg
gtctga

DBGET integrated database retrieval system