KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00404Help
Entry
BLNIAS_00404      CDS       T01845                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:blk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340011..340673
Genome map
AA seq 220 aa AA seqDB search
MEHDSSRSGYHEPEPGSAGLSATEEDWGDDYPKTFSVNLIWAEARDKEGRAGAIGLNGGM
PWHCAEDMKHFKELTVSHPVIMGRKTWESLGGKYRPLPNRDNIVVSHDPMYRAPGATVVT
SLDDALDMARQEAIPDDGLDRSEIWIIGGAQLFAKALPFADKAYVTDLAATVDADSYAPD
MASLVEAGMWREAEVGEWRTPAKEESGIDSYRFRILVKTK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgacagtagccgtagcggctatcacgaacccgagcccggatctgccgggctg
tctgccactgaagaagactggggtgacgattatcccaagaccttctcggtgaatcttatc
tgggccgaagcccgtgacaaggaaggtcgcgccggtgccatcggcctcaatggtggcatg
ccttggcactgtgccgaggatatgaagcatttcaaggagctgaccgtctcccatccggtg
attatgggtcgtaagacctgggaatcgctggggggcaagtaccggccgctgcccaaccgc
gacaacatcgtcgtttcccacgatccgatgtaccgtgcgccgggggccactgtggtcacc
agtcttgacgacgcgctcgatatggcccgtcaggaggcgattccggacgacggtctggac
cgttcggagatttggatcatcggcggcgcccagttgttcgccaaggctttgccgttcgcg
gacaaagcctatgtgactgatctggccgccaccgtggatgccgacagctacgcgcccgat
atggcgtcgctggtcgaggccgggatgtggcgggaagccgaagtgggtgagtggcgtacg
cccgccaaggaggagtccggcatcgattcctatcgtttccgtatcttggtcaaaaccaag
taa

DBGET integrated database retrieval system