KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00404Help
Entry
BLNIAS_00404      CDS       T01845                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00670  One carbon pool by folate
blk00790  Folate biosynthesis
blk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLNIAS_00404
   00670 One carbon pool by folate
    BLNIAS_00404
Enzymes [BR:blk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BLNIAS_00404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AEI96841
UniProt: F8ASM0
Position
340011..340673
Genome map
AA seq 220 aa AA seqDB search
MEHDSSRSGYHEPEPGSAGLSATEEDWGDDYPKTFSVNLIWAEARDKEGRAGAIGLNGGM
PWHCAEDMKHFKELTVSHPVIMGRKTWESLGGKYRPLPNRDNIVVSHDPMYRAPGATVVT
SLDDALDMARQEAIPDDGLDRSEIWIIGGAQLFAKALPFADKAYVTDLAATVDADSYAPD
MASLVEAGMWREAEVGEWRTPAKEESGIDSYRFRILVKTK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgacagtagccgtagcggctatcacgaacccgagcccggatctgccgggctg
tctgccactgaagaagactggggtgacgattatcccaagaccttctcggtgaatcttatc
tgggccgaagcccgtgacaaggaaggtcgcgccggtgccatcggcctcaatggtggcatg
ccttggcactgtgccgaggatatgaagcatttcaaggagctgaccgtctcccatccggtg
attatgggtcgtaagacctgggaatcgctggggggcaagtaccggccgctgcccaaccgc
gacaacatcgtcgtttcccacgatccgatgtaccgtgcgccgggggccactgtggtcacc
agtcttgacgacgcgctcgatatggcccgtcaggaggcgattccggacgacggtctggac
cgttcggagatttggatcatcggcggcgcccagttgttcgccaaggctttgccgttcgcg
gacaaagcctatgtgactgatctggccgccaccgtggatgccgacagctacgcgcccgat
atggcgtcgctggtcgaggccgggatgtggcgggaagccgaagtgggtgagtggcgtacg
cccgccaaggaggagtccggcatcgattcctatcgtttccgtatcttggtcaaaaccaag
taa

DBGET integrated database retrieval system