KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00472Help
Entry
BLNIAS_00472      CDS       T01845                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLNIAS_00472
Enzymes [BR:blk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BLNIAS_00472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393725..394324
Genome map
AA seq 199 aa AA seqDB search
MNEYIESCQREKRTYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQA
SPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARL
VEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVR
GMLRNPATRAEAMSLILDK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatatatagagtcttgccagcgggagaaacgcacatacgacgaggaaggcgtg
cgcgaagccgtacgcctgttcctgaagtcgattggcgaggatcccgagcgcgaggggctg
gtggaaacgcctgaccgtatcgcccgcgcgtgccgcgagctgttcgccggtctgcaggct
tccccggccgatgtgctggagaagcacttcgacgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtgtgcgagcatcacctgctgccgttccacggcgtggcc
catgtgggctatattcccgccaaggacggggtgatggggctgagcaagctcgcccgactg
gtcgaggtgtatgctcgccggccgcaggtgcaggagcgtttgacccagcagatcgccgac
gcgctggtcgagtatgcgggcgcacgtggcgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgcggcatcaagaagtcttccgcccgcacggtgacctctgcggtgcgc
ggcatgctgcgcaatccggccacccgagccgaagccatgagcctcattttggataaatag

DBGET integrated database retrieval system