KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00474Help
Entry
BLNIAS_00474      CDS       T01845                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395371..396783
Genome map
AA seq 470 aa AA seqDB search
MDTITLTGVHANGTHGVLAFEHERPQTFVVDVTLHLDLAAAGQSDDLNDTIDYGRVAKDI
TAVIEGPHVDLIERLAQRIADEILADAPAVASIDVTVHKPHAPIVVAFADVSVSISRVRA
TDNGRTAEEHAIHNAVVALGGNVGEVESTLRAAVREIDALPGTQVTGISPLYRTAAWGMA
DGTPDFLNAVVELETTMGSHELLAALQNIEASHGRIRENHWDSRPLDLDIIDFDGITSAD
PDLALPHPRAWQRAFVLAPWLALNPNAKLAGAHEGPVADLLATAPDRNAVQLESEDWMLG
GHAVKQESASESAPVSRKAIISLDSTSQDAERLFRETIVSIDSVPGNQVQGISPLYHVSH
FDGPDAMSAVIQIETKLPPADLIAVLGSIESVHDLAVDLDLVDMEGVTSDEPNCSIPWPS
ARNHASVLAPWLDMDPNATLGGDPVAFLLAMAPDAGQVGLLSDNWILSNS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggacaccatcacacttaccggcgtacatgccaacggcacccacggtgtgctcgccttt
gaacacgaacggccacaaaccttcgtcgtggacgtcaccctgcaccttgatctggccgca
gccggtcaatccgacgatctcaacgacaccatcgattacggccgtgtggccaaggacatc
acggctgtcatcgaaggccctcatgtggacctgatcgagcgtctggcccaacgtatcgcg
gacgagattcttgccgatgcgccggccgtcgcctccatcgacgtcaccgtgcacaagcct
cacgcacccatcgtcgtggcttttgcagatgtatcggtctccatctcgcgcgtgcgtgcc
accgataatggacgcactgctgaagagcatgccatccataacgcggtggtggccttgggt
ggcaatgtgggcgaggtggaatccaccttgcgagccgccgttcgggagattgacgcgttg
cctggcacacaggtgaccggtatctcaccgctttaccgcacggccgcgtggggcatggcc
gacggtacgccggatttcctgaacgccgtggtggagcttgaaaccacaatgggcagccac
gaattgcttgccgcgttgcaaaacatcgaagcgagccatggacgaattcgtgagaatcat
tgggattccaggccgttggacttggacattatcgactttgatggcatcaccagcgcggat
ccggatctggcattgccccatccgcgtgcttggcagcgtgcgtttgtgctggctccttgg
ttggcattgaatccgaacgccaaactcgccggagcccatgaggggcctgtagccgatttg
ctggccaccgcgccggaccgtaacgccgtgcagctcgagagcgaagactggatgctcggc
gggcatgcagtcaagcaagaatccgcgtcggagtcggcacccgtctcacgcaaggcgatt
atttcgctggattccacctcgcaggatgccgaacggctgttccgcgaaaccatcgtttcc
atcgacagtgttcctggcaatcaggtacaaggcatttcgccgctctaccatgtcagccat
ttcgacggcccggacgcgatgagcgcggtcatccaaatcgaaaccaagttgccgcccgcc
gacctgattgccgtattgggcagcatcgaaagcgttcatgatctggcagtcgaccttgac
cttgtcgacatggaaggcgtgacttccgatgagcccaactgcagcattccttggccgtcg
gcccgtaaccatgcgtcggtattggcaccttggctggatatggacccgaatgctactctg
ggcggcgacccggtggccttccttttggccatggcaccggatgccggacaggtcggattg
ctatcggacaactggatactgtcgaacagttga

DBGET integrated database retrieval system