KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00502Help
Entry
BLNIAS_00502      CDS       T01845                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLNIAS_00502
   00051 Fructose and mannose metabolism
    BLNIAS_00502
Enzymes [BR:blk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     BLNIAS_00502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414452..415801
Genome map
AA seq 449 aa AA seqDB search
MGLWDVDKIEYVGRAKGPKEDFAFHYYDADKVVAGKKMKDWLRFGVAWWHTFNQELVDPF
GTGTAHRPYYKYTNPMDQALAKVDYAFELFQKLGVEYFCFHDRDIAPEGDTLRETNANLD
KVVDKIDENMKSTGVKLLWNTSSLFTNPRFVSGAATSPFADIYAYAGGQLKKSLEIGKRL
GAENYVFWGGREGYENLWNTEMKRETDHIAKFFHMCADYAKEIGFEAQFLIEPKPKEPTL
HQYDFDAATAIEFLRNHDLTDVFKLNLEGNHANLAGHTYQHEIRVARESGFLGSLDANQG
DKLIGWDMDEFPTDLYETVAVMWEVLQAGSIGPHGGLNFDAKPRRTSFYEEDLFRSHIAG
MDAYAAGLLVADKMNQDGFIQNLQAERYSSYDSGIGKDIDEGNVTLADLEAYSLDKPQSE
LIAATKSDHLESVKATINNYIIDALAEVE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggtctgtgggatgttgacaagatcgagtacgtcggccgcgccaaaggaccgaaggaa
gacttcgccttccattactacgatgccgacaaggtcgttgccggcaagaagatgaaggat
tggctgcgcttcggcgttgcttggtggcacaccttcaaccaggaactggttgatccgttc
ggcaccggcaccgcgcaccgcccgtactacaagtacaccaatccgatggaccaggctctg
gccaaggtcgactacgccttcgagctgttccagaagctgggcgtcgagtacttctgcttc
cacgatcgtgacatcgcccccgaaggcgacaccctgcgcgagaccaacgccaacctcgac
aaggtcgttgacaagatcgacgagaatatgaagtccaccggtgtcaagctgctgtggaac
acctcctccctgttcaccaacccgcgcttcgtgtccggcgccgccacttctccgttcgcc
gacatctacgcctacgccggtggccagctcaagaagagcttggagatcggcaagcgcctg
ggcgccgagaactacgtgttctggggtggccgcgaaggctacgagaacctgtggaacacc
gagatgaagcgcgagaccgaccacatcgccaagttcttccacatgtgcgcagattacgcc
aaggaaatcggctttgaggcccagttcctgatcgagccgaagccgaaggagccgacgctg
caccagtacgacttcgatgccgccaccgccatcgagttcctgcgcaaccacgacctgacc
gacgtcttcaagctgaacttggaaggcaaccacgccaacctggccggccacacctaccag
cacgagatccgcgtggcccgcgagtccggcttcctcggttccctcgacgccaaccagggc
gacaagctcatcggctgggatatggacgagttcccgaccgatctgtacgagaccgtcgcc
gtcatgtgggaagtcctgcaggccggctccatcggacctcacggtggtctgaacttcgac
gccaagccgcgccgtacctccttctacgaggaggacctgttccgctcccacatcgccggc
atggatgcctacgccgccggcctgctggttgccgacaagatgaaccaggacggcttcatc
cagaatcttcaggccgagcgctacagctcctacgactccggcatcggcaaggacatcgac
gagggcaacgtcaccttggccgacctcgaagcctacagcctcgacaagccgcagtccgag
ctcatcgccgccaccaagtccgatcacctcgagtctgtcaaggccaccatcaacaactac
atcattgatgccctggctgaggtcgagtga

DBGET integrated database retrieval system