KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00639Help
Entry
BLNIAS_00639      CDS       T01845                                 

Gene name
rbsK
Definition
PfkB family sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLNIAS_00639 (rbsK)
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLNIAS_00639 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
532039..533007
Genome map
AA seq 322 aa AA seqDB search
MSASCLDLLDHLHGSVSVVGSMNVDYTVVTERLPKPGETVNGGPLTLLPGGKSANQASAA
ARIGAQVRMFGAVGEDTNADFLLEHLRDAGVDTSHIAAVAGPSGTTVITVDANGENAIVY
SAGSNGEVSVDYVQQSSDALVAADVLGLCLESPMETVTACARLCHDAGLKVLLNDSPFVA
ELPAELIEASDILLVNEHEMAQLLDIAEPDDDDWDGLDWSDVARQMHDFGFNQAVITLGG
DGSVVIDGDDIYRIAPVAVEAIDTTGCGDAFMGTVLAGLASGHALADSAQLASYVSAYAA
TGFGAQASYGTAAQIRERFGTN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatcatgtcttgacttgctcgaccacctgcacggcagtgtgtccgtggtcgga
tcaatgaatgttgattacacggtcgttactgagcggttgccgaaaccgggagagaccgtc
aacggtggcccgctgaccttattgccgggaggcaagtcagcgaatcaggcatcggcggct
gcgcgaattggagcgcaggtgcggatgtttggtgcagtcggggaagataccaatgcggat
tttctgctggagcatttgcgcgatgctggtgtggatacttcgcatatcgctgccgttgca
ggtcccagtggcactacggtaattaccgtggacgcgaatggcgagaacgccatcgtatat
tcggctggttccaatggtgaggtatctgtcgactatgtgcagcagtcatctgatgcattg
gttgccgccgatgtactgggactgtgtttggaaagtccgatggaaacggtcacggcatgc
gctcgcctctgtcatgatgccgggctcaaggtattgctcaacgattcgccattcgttgct
gaactacccgctgaacttatcgaggcttcggacattctgctggtcaatgaacatgaaatg
gcacagctgctggacatcgccgagcctgacgatgacgattgggatggactggactggtct
gatgtggcgcggcagatgcatgacttcggctttaatcaggcggtaattacgcttggcggg
gatgggtcggtagtcatcgatggtgatgatatctatcgtattgcgccagttgcggttgag
gccatcgacactaccgggtgcggagatgcctttatgggcacggttctggccggactcgcc
tcgggtcatgcgttggcggacagcgcgcagttggcctcatacgtttccgcgtacgccgcg
actgggttcggcgcgcaagcctcttatggtactgccgctcagattcgtgagcggtttggt
acgaattga

DBGET integrated database retrieval system