KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00781Help
Entry
BLNIAS_00781      CDS       T01845                                 

Definition
glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLNIAS_00781
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLNIAS_00781
   00520 Amino sugar and nucleotide sugar metabolism
    BLNIAS_00781
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BLNIAS_00781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647461..648228
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgcacaggctttcggtgttgacattggcggttccggcatcaaggccgca
cctgtcgatctgaccaagggcgatttcgccgagccacgattgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgctttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaaccttgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtaaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatttacaacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aatgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gagaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgatcgtgcccgccaagctgcgtaaccag
gccggcatcgtcggtgccgcctactatgccagcaccaagcagcagtga

DBGET integrated database retrieval system