KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00781Help
Entry
BLNIAS_00781      CDS       T01845                                 

Definition
(GenBank) glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00010  Glycolysis / Gluconeogenesis
blk00520  Amino sugar and nucleotide sugar metabolism
blk01100  Metabolic pathways
blk01110  Biosynthesis of secondary metabolites
blk01120  Microbial metabolism in diverse environments
blk01130  Biosynthesis of antibiotics
blk01200  Carbon metabolism
Module
blk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLNIAS_00781
   00520 Amino sugar and nucleotide sugar metabolism
    BLNIAS_00781
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BLNIAS_00781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEI97094
UniProt: F8AU06
Position
647461..648228
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgcacaggctttcggtgttgacattggcggttccggcatcaaggccgca
cctgtcgatctgaccaagggcgatttcgccgagccacgattgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgctttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaaccttgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtaaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatttacaacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aatgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gagaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgatcgtgcccgccaagctgcgtaaccag
gccggcatcgtcggtgccgcctactatgccagcaccaagcagcagtga

DBGET integrated database retrieval system