KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00824Help
Entry
BLNIAS_00824      CDS       T01845                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BLNIAS_00824
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BLNIAS_00824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
681062..681652
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLT
EDEFLAREAAGEFLETAVVHGMAHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgctggccgtctaatcgtcctgactggccccaccgcagtaggt
aagggcaccgtggaagccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtctcc
gccaccacacgcgctccgcgcccgggcgaggttgatggcgtcaactattggttcctcact
gaagacgagttcctggcccgtgaggcggccggtgagttcctggaaactgcagtggtgcac
ggcatggcccattatggcaccttgttgaagcctgtggaggaacatctggccgccggtgtg
cccacgattctggaaatcgacctgcagggtgcccgccgcgtcaagcagcgcgccgccgag
ctcgacctcgaagtggtgtacgtgttcatcgcgccgccaagcttcgaagagctcgagcgc
cgcctgatcggccgcggcaccgaaaccgccgaacagcaggcccgtcgcttggagaccgcc
aaggtggagctcgccgccgaaagcgaattcgacgtcaccatcgtcaacgaaaccgtcgat
caggccgctgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system