KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00950Help
Entry
BLNIAS_00950      CDS       T01845                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLNIAS_00950
  Amino acid metabolism
   00340 Histidine metabolism
    BLNIAS_00950
Enzymes [BR:blk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BLNIAS_00950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786435..787832
Genome map
AA seq 465 aa AA seqDB search
MSENIMRIIDLRGQNLSRAELLAAMPRAAMGTSEATDLVRPILDDVKERGAAALRDFEEK
FDHVRPKNLRVPVEAIKDALTTLDPEVRAAIEESVRRARAVAANQVPKDFYTDLAEGARV
AERWIPIQRVGLYVPGGKAVYPSSVIMNAVPAQAAGVESLAIATPPARDNEEGLPNKTIL
ATCAILGVDEVYAVGGAQAIAMFAYGAKGSEPQDGDILCDPVDKITGPGNIFVATAKSLV
SAFVGIDAVAGPTEIGIIADETANPSLLAADLIGQAEHDELAGSVLFTDSTEIADKVQES
LKYRVPRTEHAERVHTSLSGTQSAIVLTDGLDQSIDAANAYAAEHLEIQTKDADAVVKRI
KNAGAIFRGPYSPVPLGDYMSGSNHVLPTGGTARFAAGLGVHTFMKPVEVIEYDEEGLKA
LAARINAFAVSEDLPAHGECVLSRFVKDPYDKATLREQEKEAGLR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacatcatgcgaatcattgacctgcgtggtcagaacctgtcccgtgccgaa
ctgcttgccgcgatgccgcgtgctgcaatgggtacttccgaagccaccgatttggtgcgt
ccgattctggacgatgtcaaagaacgcggcgccgctgccctgcgcgacttcgaggagaag
ttcgatcacgtgcgtcccaagaacctgcgcgtgccggtcgaggcgatcaaggacgccctg
accacgctcgaccccgaagtgcgcgccgccatcgaggaatcggtgcgccgcgcccgcgcc
gtggccgccaaccaggtgccgaaggacttctacaccgacctcgccgaaggcgcccgcgtg
gccgaacgctggattccgattcagcgcgtcggcctgtatgtgcccggcggcaaggccgtc
tacccgagctccgtcatcatgaacgctgtgccggcccaggccgccggcgtcgaatcgctg
gccatcgccaccccgcccgcccgcgacaatgaggaaggcctgccgaacaagaccatcctc
gccacctgcgccatcctcggtgttgacgaggtatacgcggtcggcggcgctcaggccatt
gccatgttcgcatacggcgccaagggcagcgagccgcaggacggcgacatcctgtgcgat
ccggttgacaagatcaccggcccgggcaacatcttcgttgccaccgccaagtcgctggtc
tccgcattcgtgggcattgacgcggttgccggccccaccgaaatcggcatcatcgccgac
gaaaccgccaacccgagcctgctggccgccgacctcatcggccaggccgagcacgatgag
ctcgccggttccgtgctgttcaccgactccaccgagattgccgacaaggtgcaggagagc
ctcaagtaccgcgtgccgcgtaccgagcacgccgagcgtgtccacacgtcgctgtccggc
acccagtctgccatcgtgctgaccgacggtctcgaccagtccatcgacgcggccaacgcc
tacgccgccgaacaccttgagattcagaccaaggatgccgatgcggtcgtcaagcgcatc
aagaacgccggtgccatcttccgcggtccgtactccccggtgccgctgggcgactacatg
tccggctccaaccacgtgctgcccaccggcggcaccgcccgcttcgccgcaggcctcggc
gtgcacaccttcatgaagccggtcgaagtcatcgaatacgacgaggaaggcctcaaggcc
ctcgccgcccgcatcaacgccttcgcggtatccgaggacctgcccgcccacggcgagtgc
gtgctctcccgcttcgtcaaggatccgtatgacaaggccaccctgcgcgagcaggagaag
gaagccggtctgcgatga

DBGET integrated database retrieval system