KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01195Help
Entry
BLNIAS_01195      CDS       T01845                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLNIAS_01195
   01230 Biosynthesis of amino acids
    BLNIAS_01195
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLNIAS_01195
  Energy metabolism
   00680 Methane metabolism
    BLNIAS_01195
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLNIAS_01195
Enzymes [BR:blk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLNIAS_01195
Exosome [BR:blk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLNIAS_01195
  Exosomal proteins of melanoma cells
   BLNIAS_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979181..980026
Genome map
AA seq 281 aa AA seqDB search
MIDEVMMLRHGRTQYNLEHRLQGQIDVPLDIVGQWQVDQTGFALASRYYWAKVNRLAEHP
EAIAQPGPDAAERTDTRQFEEAPAAGRRMVVMTSDLFRAQQTAHAFADILGLPVTCDQRL
RERSFGEWEGMTRAEIKAVAADDYASWKQHTGGETKHGVESRAAVGQRGADAVRALVIDS
AYSDSTPTTLMLVTHGSWITATISNLLELDPDGMNALGGMRNACWCRLKVRHSVNGTPIE
QPLWELEEYNKAPAIADSADWENGPTDLRGPHMPSWQPIVW
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgaagtgatgatgctgcgtcatggccgtacgcaatacaatctcgaacatcgc
ttgcaaggccagatcgatgtgccgctcgacatcgtaggccaatggcaggttgaccagacc
ggattcgcgctcgcttcacggtattactgggccaaggtgaaccgacttgccgagcatccc
gaagccatcgcccagcccggtcctgacgccgccgaacgcactgatacgcgccagttcgag
gaggctcccgccgccggccggcgcatggtggtgatgacctccgacctgttccgtgcccaa
cagaccgcacacgccttcgccgatattttgggattgccagtcacctgtgaccaacgactg
cgtgaacgcagcttcggcgagtgggaaggcatgacccgcgccgaaatcaaagccgtggca
gccgacgactacgcctcttggaaacagcacactgggggcgaaaccaagcatggtgtggaa
agccgtgccgccgtggggcagcgaggtgccgatgccgtgcgcgcactggtcatcgactcc
gcctattcagacagcacgcccaccacgctgatgctcgtcacccatggctcatggattacc
gccaccatctccaacctgctcgaacttgacccggacggcatgaacgcactcggcggcatg
cgcaacgcctgttggtgccggctcaaagtgcgccacagcgtcaacggcacccccatcgaa
cagcccctgtgggagttggaggaatacaacaaggctcccgccatcgccgacagcgccgac
tgggagaacgggccgaccgatctgcgaggaccgcacatgccaagttggcagccaatcgtc
tggtga

DBGET integrated database retrieval system