KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01381Help
Entry
BLNIAS_01381      CDS       T01845                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:blk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1115924..1116550
Genome map
AA seq 208 aa AA seqDB search
MIGMLTGRVESVETDTALIDVGGVGYEVRMSATDLSRLHAGQDTRVFTYMNLSQDAITLH
GFLDRDAKKTFLQLIKVSGIGPKVAQSLLSTLTPSQLAHAIADNDATALAKAPGLGKKGA
QKIILELKGSIDLSQIEGASAQAAISKSPVDTGTEQVVEGLISLGWRQQDAQQAVAEACA
ENDIPTPLATDDVPRVLRLALALMDRGR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgctgaccgggcgggttgaatcggtcgaaaccgataccgcattgattgat
gttgggggagtgggctacgaagtgcgcatgtccgccaccgacctgagccgtctgcacgcc
gggcaagacacccgcgtcttcacctatatgaacctctctcaggatgccattaccctgcat
ggattcctggatcgggacgccaagaaaaccttcctacaactcatcaaggtctccggcatt
gggcctaaagtggcccaatcgttactctccacactgacgccgagtcagctggcccacgcc
atcgccgacaacgacgccaccgcgctggccaaggctccggggctgggcaagaagggcgca
cagaaaatcatcctcgagcttaagggctctattgatttgagtcagatcgagggtgcttcc
gctcaggcggcaatatccaagtctccggtggataccggtacggaacaggttgtcgaagga
ctgatttcacttggctggcgtcagcaggacgcccaacaggccgttgccgaggcttgcgcc
gaaaacgatattcccacgccgcttgccaccgacgatgtgccgcgtgtgctacgtctggct
ttggcgctgatggataggggccgctga

DBGET integrated database retrieval system