KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01400Help
Entry
BLNIAS_01400      CDS       T01845                                 

Definition
udp-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLNIAS_01400
   00052 Galactose metabolism
    BLNIAS_01400
   00500 Starch and sucrose metabolism
    BLNIAS_01400
   00520 Amino sugar and nucleotide sugar metabolism
    BLNIAS_01400
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLNIAS_01400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1128743..1130272
Genome map
AA seq 509 aa AA seqDB search
MTEINDKAQLDITAAGDTDAVTSDTPEETVNTPEVDETFELSAAKMREHGMSETAINQFR
HLYDVWRHEEASSWIREDDIEPLGHVPSFHDVYETINHDKAVDAFAKTAFLKLNGGLGTS
MGLDKAKSLLPVRRHKAKQMRFIDIIIGQVLTARTRLNVELPLTFMNSFHTSADTMKVLK
HHRKFSQHDVPMEIIQHQEPKLVAATGEPVSYPANPELEWCPPGHGDLFSTIWESGLLDV
LEERGFKYLFISNSDNLGARPSRTLAQHFENTGAPFMAEVAIRTKADRKGGHIVRDKATG
RLILREMSQVHPDDKEAAQDITKHPYFNTNSIWVRIDALKDKLAECDGVLPLPVIRNKKT
VNPTDPDSEQVIQLETAMGAAIGLFNGSICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDT
YEMEDGNYIFPNVELDPRYYKNIHDFDERFPYAVPSLAAANSVSIQGDWTFGRDVMMFAD
AKLEDKGEPSYVPNGEYVGPQGIEPDDWV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaataaacgataaggcccaactggatatcaccgccgccggcgacaccgacgcc
gtcacctcggatacccccgaagaaaccgtaaacacccccgaagtggatgagactttcgag
ctttcggccgccaagatgcgcgagcatggcatgagcgaaaccgccatcaaccagttccgc
catttgtatgacgtatggcgccatgaagaagcctccagctggattcgcgaggacgacatc
gagccgcttggccacgtgcccagcttccacgacgtctatgagaccatcaaccacgacaag
gccgtggacgccttcgccaaaaccgcattcctcaagctcaatggcggtctgggcacctcc
atgggattggacaaggccaagtcgctgttgccggtgcgtaggcacaaggccaagcagatg
cgcttcatcgacatcatcatcggtcaggtgcttaccgctcgtacacgcctgaacgtcgag
ctgccgctgacgttcatgaactccttccacacttcggcggacacgatgaaggtgctcaag
catcatcgcaagttcagtcagcatgacgtgccgatggaaatcatccagcatcaggaaccc
aagctcgtggccgccaccggcgaacctgtgagctaccctgcgaacccggagctggaatgg
tgcccgcccggccacggcgacctgttctccaccatctgggagtctggtctgcttgacgta
ttggaggagcgcggcttcaagtatctgttcatctccaattccgacaatctcggtgcgcgc
ccctcgcgtacgttggcccagcacttcgaaaacacaggtgccccgtttatggctgaagtg
gccatccgcaccaaggccgatcgcaagggcggccatattgtacgagacaaggccactggt
cgcctaatactgcgtgaaatgagccaggtccatccggacgataaggaagcggcccaagac
atcaccaagcatccttacttcaacaccaactcaatctgggttcgcatcgacgctttgaaa
gacaagctcgccgaatgcgatggtgtgttgccgttgccggtgattcgtaacaaaaagacc
gtgaatcccacggacccggattccgaacaggtgattcagctggaaaccgccatgggcgcc
gcaatcggtctgttcaacggttctatctgcgtccaagtggatcgtatgcgcttccttccg
gtgaaaaccaccaatgatttgttcattatgcgttccgatcgattccacctgacggacacg
tatgagatggaagacggcaattacatcttcccgaacgtcgaacttgatccgcgatactac
aagaacatccacgatttcgacgaacggttcccctacgccgtgccatctttggccgcagcc
aactcggtttccattcagggcgactggacattcggacgtgacgtcatgatgttcgccgac
gccaaactggaagataaaggcgagccaagctatgtgccgaacggcgaatacgttggtccg
caaggcatcgaaccggacgattgggtgtga

DBGET integrated database retrieval system