KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01452Help
Entry
BLNIAS_01452      CDS       T01845                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00260  Glycine, serine and threonine metabolism
blk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
blk01100  Metabolic pathways
blk01110  Biosynthesis of secondary metabolites
blk01130  Biosynthesis of antibiotics
blk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLNIAS_01452
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLNIAS_01452
Enzymes [BR:blk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLNIAS_01452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB
Motif
Other DBs
NCBI-ProteinID: AEI97534
UniProt: F8AQE0
Position
complement(1161384..1162253)
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFRTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFARDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatcggctac
ctgccctacggcttccctaacccggacgtctcgcttgacgccttcaggacgatggtcgag
cacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgtttcgcccgcgacttcgagaacgccggcggcgcc
ggtctcatcaccccggaccttatcccggacgaggcgggggagtggatcgaagcctccgac
cgccacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcacgtggcttcgtgtacgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactgctcgtggagcgcacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtaa

DBGET integrated database retrieval system