KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01455Help
Entry
BLNIAS_01455      CDS       T01845                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLNIAS_01455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLNIAS_01455
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLNIAS_01455
Enzymes [BR:blk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLNIAS_01455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1162277..1164364)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRARELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYERGGASAISVLTEGRRFLGGLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARQAG
AKVIGINARNLKNLKVDVNKYNELAADLPDNVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYNEAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFAALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGTKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGAHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcgcccgtgagctc
accgtatcgcttgaggacgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtcc
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aggggcggcgcaagcgccatctccgtgctcaccgaaggccgcagattcctcggcggcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccggtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgatctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcatctgctcgacctggcgcacgagctcggc
atgaccgtgctggtggagacgcacactcgcgaggagatcgaacgcgcacgccaggccgga
gccaaggtgatcggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgataacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgtgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgatgatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctgatcaccgccctcgacgagcttgagcgc
gtctacaatgaggccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgcccgagcccgctgaccgaagccccgcgcttcgccgcactggtcaag
gagaagaccggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggt
gcgcacaagatcaacaacgcgctcggacaggccctgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggtgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgaccctcggcgacaag
atcctgaaggatgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggtccacacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaagccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
accaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatctcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaagcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggctacctgaccgacgaccag
gccgccgcgctcgatgtgaccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system