KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01543Help
Entry
BLNIAS_01543      CDS       T01845                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BLNIAS_01543
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BLNIAS_01543
Enzymes [BR:blk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BLNIAS_01543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210615..1211595)
Genome map
AA seq 326 aa AA seqDB search
MSEETPMVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEIAHTCDGRVLATLFYEPSTRT
RLSFETAMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVAS
RAASVPVINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLC
RFGNVRFVLISPDELKTPQYVIDRINATDSCSYVEVRDLASVIGDLDVLYMTRVQKERFF
NEDDYLRLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLV
RMALESTVVGDELPGYEPLNPKEVQA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgaagaaacgccaatggtcggcaaaagcgtcgtaacgctggacggcctgtctaca
aaccagattctcgacctgctgcataaggccgaatacatcgattcccaccgcaaagagatt
gcccatacctgcgatgggcgagtgctggccacgctgttctacgagccctccacccgtacg
cgcctgagctttgagaccgcaatgctacgtctcggcggcaaggtcatcggattcgccggc
gcgcagctggcctccgtgaccaagggcgaatccatcgccgacacgttgaagaccgtgtcc
aactacgtggacgtggtcgccatccgtcacccgaaggagggtgccgcgctggtggcctcc
cgcgccgcatccgtgccggtaatcaacgccggcgacggcggccacatgcaccccacgcag
acgctggccgacctggccacgctgcagtcgcgcttcggccgcatcaccgacctgaccgtg
ggactgtgcggcgatttgaccttcggccgcaccgtgcactccctgatcgagaccctgtgc
cgcttcggcaacgtgcgcttcgtgctcatcagcccggacgagctcaagaccccgcagtac
gtgatcgaccgcatcaacgccaccgacagctgctcctacgtggaagtgcgcgacctggcc
tccgtgatcggcgacctcgacgtgctgtacatgacccgcgtacagaaggaacgcttcttc
aacgaagacgactacctgcgcctgcgcgacacctacattctcgacgaagagaagctgcag
ctcgccaagccgtccatggccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtg
gacgtggacgacgacccgcgtgccgcctacttcgaacaggtcaagaacggcatgctcgtg
cgcatggccctcgaaagcaccgtggtgggcgacgaactgcccggatacgaaccgctcaac
cccaaggaggttcaggcctga

DBGET integrated database retrieval system