KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01696Help
Entry
BLNIAS_01696      CDS       T01845                                 

Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:blk00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1329407..1330027
Genome map
AA seq 206 aa AA seqDB search
MTMTKALIVVDVQPTFCESGELGVAGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPGA
HWSAEPDFVDTWPKHGAAGTLNAELHPAIKALNIEHHFKKGQYSAAYSGFEGIEDNTGRI
QTREEVEAEQSAGKTLANALKAAGVSRVDVVGIAESHCVKDTALDAKKLGFEVTVFEDLT
VPVSEELGVAARKQMAAGGITLAESR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaccaaggcactgattgtggtggatgtgcagccgacgttctgtgaaagcggc
gaactgggtgtcgcaggcggcaacgcggtcgccgagcggattgccgattatgtgaacgcg
catcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatcgagccgggcgcg
cactggtcggcggagccggatttcgtggacacgtggccgaagcatggtgcggccggcacg
ctgaacgccgaattgcatccggcgatcaaggcgctgaacatcgagcatcatttcaagaag
ggccagtattcggcggcatattccggttttgagggtatcgaggacaataccggccgtatc
cagacccgcgaggaggtcgaggccgagcaatccgccggcaagacgctggccaacgcgctg
aaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgtgtcaag
gacaccgcgctcgatgccaagaagctcggcttcgaggtcaccgtgttcgaggatctgacc
gtgccggtcagcgaggaacttggtgttgcggcccgcaagcagatggctgcgggcggcatc
acattggctgagtcccgctga

DBGET integrated database retrieval system