KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01866Help
Entry
BLNIAS_01866      CDS       T01845                                 

Definition
glycosyl hydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470666..1472918
Genome map
AA seq 750 aa AA seqDB search
MAEETKIKEDTVTVPVAQGDLDAVSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVVTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYRYMP
TVGDMDTYLFGEGRHEKLWETLGAHVLRYDDPMGGADGTPGEQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPMERQHE
VPPNTASIVTESTYKWNDDAWMQHRRTTNPHDGPVSIYEVHAGSWRQGLTYRDLAKQLVD
YVKQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGHWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
VIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSEHYVLPISHDEVVYGKGSLYGKMPGDDWQKLAGVRSMFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLASDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EAVEGEYHSRPFSAKITVPALGVVFLKPED
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaacgaagatcaaggaagataccgtcaccgtgcctgtcgcccaaggcgac
ctcgatgcggtgagcaatgctgaattctacaatccccacggagttctcggcgggcatctc
ggcatcggcaagcatgccgacaccgccacaatccgcgtgctgcgtccgcttgccaagtcc
gtgaccatcctcacccaggatggcgaatacccgatgacccacgaatacaacggcgtgttc
gtggttaccgtgccggcttccggcactaagaagcagcccacgattcccgactaccgtgtc
aggaccgagtgggaaagcggcgcagtgctcattgaggacgacccatatcgctatatgccc
acagtcggcgacatggacacctatctgttcggcgagggccgtcacgagaagctctgggag
acgcttggcgcgcatgtgctgcgctatgacgatccgatgggcggcgcagacggcacgccc
ggcgaacaggtggtaggcaccgcattctccgtgtgggccccgaacgcccatgccgtgcgc
gtagtcggtaacttcaacgcttgggatggccgccgtcatgccatgcgcgagctcggctcc
tccggcgtgtgggagatcttcatccccggaatcggcgcgggcgagacctacaagttccag
atcctgaacgccaattacacgtgggagatgaaggctgacccgatggagcgtcagcacgaa
gttccgccgaacaccgcctccatcgtcaccgaatccacctacaagtggaacgatgacgcc
tggatgcagcaccgccgcaccaccaacccgcatgatggcccggtctccatctatgaggtg
cacgccggcagctggaggcagggactgacctaccgcgacctggccaagcagctcgtggac
tacgtcaagcaggaaggcttcacccacgtggagttcatgccactggcccagcacccgttc
tccggctcctggggctatcaggtcaccggctactatgcggtcgactcccgtctcggttcc
cccgacgacttccgttacctggtcgaccagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgcccacttcccgaaggatgccttcgcgctcggccgcttcgacggcacc
ccgctgtacgaggacccggacccgctgcgcggcgaacaccctgaatggggcacctatgtg
ttcaacttcggacgccgcgaagtacgcaacttcctggtggccaacgccctgttctggctt
gaggacctgcacgtcgatgcactgcgcgtggatgccgtcagctccatgctctacctcgac
tacagccgcgaacccggccattggcgcccgaacatctacggcggacgcgagaacctggag
gccatcgacttcctcaaggaggccaccgccaccgcgtacaagaacaaccccggcgtcatg
gtgatcgccgaggagtccaccgcatggccgggcatcaccgcccccacttccgccggcggc
atcggcttcggcatgaagtggaacatgggctggatgcacgacaccctcgagtatctgcac
gaggagcccatcaaccgcaagtggcaccacaacgagatcaccttctccatggtgtacgcc
tactccgaacactacgtattgcccatcagccacgacgaagtcgtgtacggcaagggttcc
ctgtacggcaagatgccgggcgatgactggcagaagctggccggcgtgcgttcgatgttc
gcctatcagtgggctcacccaggcaagaagctctccttcatgggcaacgagctggcccag
tggggcgagtgggatcacgacgcctccatcgattgggattgcctgaactggcaggagcac
cgtcaggtccagaccatggtcgccgaccttaacgccttctacaaggcgcatccggcacta
tggagccaggacttcgacccggccggcttccagtggctggccagcgacgatgccgaccac
aacacgctgagcttcctgcgcatcggtaccaagggcgagaccttggccgtggtggtcaac
ttctccggtgaggcctggtccgattaccaggtggcgctgcccaccggcggcaagtggacc
gaagtgttcaccaccgatgacgccaagtacggcggctccgacatccacaacggcaccttc
gaagcggtcgagggcgaatatcattcacgtccgttctcggcgaagatcaccgttccggct
ctgggagttgtattcttgaagccggaagactga

DBGET integrated database retrieval system