KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01906Help
Entry
BLNIAS_01906      CDS       T01845                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BLNIAS_01906
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BLNIAS_01906
Enzymes [BR:blk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BLNIAS_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1506905..1508107
Genome map
AA seq 400 aa AA seqDB search
MATICALAVVLAGVAAYGWHVGWFAKSTSNGNTTTPQTSQTSALPRADVPSPKKNEPAAQ
AQRAVSAMTLEERVGQLVMVPLLAGSDPSSLASTIADEHIGSAILIGNWNTGADTVKTAT
AQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQL
AAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRDAQVGAAV
KHYPGLGAVSGNTDFTTEGILDTTTTLGGAEAGAFDQAITKTDPAMVMMSLATYQSIDPN
NPAVFSSTIIDGHIRNALKYTGVVISDSMSAEALSSYDVSQLGVKLVEAGGDMSCIGQTD
YVKPIVDGLNERAKSDPAFASKVTAAATRVMALKIKMGLA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacaatatgtgctttggcagtggtgttggccggcgtggcagcctacggatggcat
gtcggatggttcgccaaatccacatcaaacggcaacaccaccactccccagacctcccag
acaagtgcgttaccacgcgccgacgttccttccccgaagaagaacgaaccggccgcacaa
gcccaacgtgcggtatccgccatgacacttgaggaacgtgtgggacagttagtgatggtg
ccgttgcttgccggttccgatccctcctcgttggcttcaacaatcgccgatgagcacatt
ggctcggccattctcattggcaattggaataccggcgccgatacggtcaagaccgcgacc
gcgcaactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcaggag
ggtggtcaggtgcagcatctgactggtaccggtttcgacacaatgcccagtgccgttgag
cagggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaatta
gctgctgctggcataaatgtcgatttggcaccggtgctcggcacggtggtgggcgatcgt
gcctcaaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggcaac
gccgaacatggcatcgccgttattgaaggtttgcgagacgctcaggtcggcgcggcggtc
aaacattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggcatt
ctggatacgaccaccacgttgggcggggccgaggcaggtgcctttgaccaggcgatcacc
aagaccgatcctgcgatggtgatgatgtcgttggccacgtatcaatccatcgacccgaat
aatccggcggtgttttcttctacgattatcgacggtcatattcgcaacgccctgaagtac
acgggcgtggtgatttcggattcgatgtctgccgaagcgttaagcagctacgatgtaagc
caattgggagtaaagcttgtcgaggcgggcggcgacatgtcctgcatcggtcagacggat
tacgtaaagccaattgtggacggcctcaacgaacgggcgaagtccgatccggctttcgct
tcgaaagtgacggcggcggcgactcgcgtaatggcattgaaaatcaagatgggactggcc
tga

DBGET integrated database retrieval system