KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01910Help
Entry
BLNIAS_01910      CDS       T01845                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLNIAS_01910
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLNIAS_01910
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BLNIAS_01910
Enzymes [BR:blk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BLNIAS_01910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511887..1513377
Genome map
AA seq 496 aa AA seqDB search
MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVASLPGKSYQQIAAEVL
GALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELFNGPTSAFKDVALQILP
RFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAITVFYPEGKVSQVQELQM
TTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSHVVLSSANSINVGRLVPQV
VYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAKLLGLPVKHLVVASDKNNVL
FDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSEGDTRLISMLMNDLNKWGTYE
IPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVIDPHTACGYYLLEQMPRDPLTPR
VLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHETGTTAPAALRGLETADVRFKDVV
AIDGMEDYVEKAAQAL
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccaccttccattccacccgtagcaccaccgattcgctgaccgccaagcaggcg
attcgtaagggcatcgccgatgacggcggcctgttcgtttcggacgcgttgggcaagacc
aaggtggacgtggcctccctgccgggcaagtcgtaccagcaaatcgccgccgaggtgctg
ggcgcgctgctgccggacttcacggccgaggagctgggccagtgcatcgccgacgcctac
ggcgaacagtggtccgatgagcgcatcaccccgctcaagcccctgggcgatgattacgtg
ctcgaactgttcaacggcccgacttccgcgttcaaggacgtggcgctgcagatcctgccg
cgcttcatggcgcacaccacgccggccgatggcgacgcggacgagaagatcatgatcctc
accgccacctccggcgacaccggcaaggccgcgctggccggcttcgcggacgccccgggc
accgcgatcaccgtcttctacccggaaggcaaggtctcccaggtccaggagctgcagatg
accacgcaggccggctccaacgtgcaggtggccgccgtggaaggcaacttcgacgacgcc
cagtccgcggtcaagcgcatcttcggcgaccgcgccctggccgagcgtctcgccggcaat
tcgcacgtggtgctttcctccgccaactccatcaacgtgggccgtctggtgccgcaggtc
gtctactacttctccgcttacgcccagctgctcgccgaccaggtgatcaacgtcggcgat
gaggtcgagtttgtggtcccgaccggcaacttcggcgatatcctcgccggctactatgcc
aagctgctcggtctgccggtcaagcacctcgtggtggcttccgacaagaacaacgtgctg
ttcgacttcctgaccaccggtacctacaaccgccagcgcccgttcttccagaccatctcc
ccctcgatggacatcctcatctcctccaacctggagcgcatgctgtactacttgtccgag
ggcgacacccgtctgatctccatgctgatgaacgacctcaacaagtggggcacgtacgag
atcccggaagagctgctggccaagattcgtcagatcttcggcaccggttgggccgatgag
gatcaggtacgcgagtccatcaagcactgttgggacgagaaccactacgtgatcgacccg
cacaccgcctgcggctactacctgcttgagcagatgccgcgcgacccgctgaccccgcgc
gtgctgctctccaccgccagcccctacaagttcccgcgcgtggtgaacgaggcattgggc
ttcgacgccaccggcaccgacttcgagtgcatggatgtgctggcccacgagaccggcacc
accgccccggccgccctgcgtggtcttgagaccgccgacgtgcggttcaaggacgtcgtg
gccatcgacggcatggaagattacgtcgagaaggccgcccaggcgctgtga

DBGET integrated database retrieval system