KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02287Help
Entry
BLNIAS_02287      CDS       T01845                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLNIAS_02287
Enzymes [BR:blk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BLNIAS_02287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1817982..1820114)
Genome map
AA seq 710 aa AA seqDB search
MTTRRAFRWPSLLTPNGRGIAFGGDYNPDQWPEETLDEDIHLMTQAGVNTVALAIFSWDK
IEPREGEFTFEWLDHVIDKLGAASIAVDLASATATAPLWLYERHPEVLPIDRYGHVVNAG
SRQSWQPTSPVLKEYALRLCRKLAEHYKDNPYVTAWHMGNEYGWNNRYDYSDNALAAFRT
WCEAKYGTVDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDSMVNPPQQLDYERFGNDMLL
DFYKAERDAIEEICPGKPFTTNFMVSTDQCTMDYAQWANEVDFVSNDHYFHEGESHLDEL
ACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGELMRDSLAHVAMGADAINFFQW
RQSASGAEAFHSAMVPHAGSDTKLFRGVCELGAALKTLSDAGVQDTELKRADTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRGYLDAGARADVVPLAYDWSGYQTIVLPTVIALSD
EDTRRIADFAENGGTVIVGYATGLIDEHFHIGLGGYPGAGNGLLRDMLGIRSEEFNILGE
EAEDEPAEIGLSNGLTTRLWQNDVTSVAPDTCVLATYVGTAAADWELDGVPAITSRTYGN
GTAIYVGCDLGRHDIARLLKEFGSCWRELSAQPTEGGQTPTYPTTDPRILHTIRRSADGS
TRFDFYLNRSNQPVAVNGIEGEPIIAYRCEADTTGYTLNRNAILIAKTSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgactactcgcagagcattccgttggccgtctttgttgacgccgaatggtcgtggcatc
gcgttcggcggtgactacaatccggatcagtggccggaggagacgctggacgaggacatc
cacctgatgacccaggctggcgtcaacactgtggccctcgccatcttcagctgggacaag
atcgaaccgcgcgagggcgagttcacgttcgagtggcttgaccacgtgatcgacaagctc
ggcgcggcgagcatcgccgtggacctggcatcggccactgccacggccccgttgtggctg
tacgagcgtcatcctgaggtgctgccaatcgatcggtacggccatgtggtcaatgcgggc
tcacgccagtcgtggcagcccacaagcccggtgctcaaggaatacgcgctgcgcctgtgc
cgcaaacttgccgaacactacaaggacaatccatacgtgacggcctggcacatgggcaac
gaatacggctggaacaaccgctacgactactccgacaacgccttggccgcgttccgcacg
tggtgcgaggccaaatacgggaccgtcgacgcgttgaacgaagcgtggggcacggccttc
tggtcccagcacgtgaacagcttcgacgaggtgttgctgcctcgccacatgggcggcgac
agcatggtcaacccgccccagcagttggattacgagcggttcggcaacgacatgctgctc
gacttctacaaggccgaacgcgacgccatcgaagaaatctgccccggcaagccgttcacc
acgaacttcatggtctccaccgaccaatgcaccatggactacgcgcaatgggcaaacgaa
gtggacttcgtgtccaacgatcactacttccatgagggcgaatcccatctggacgaactc
gcctgctcggacgcgctcatggactcgctcgcgctcggcaagccgtggtacgtgatggag
cactccacctccgccgtccaatggaagccgcttaacacgcgcaagcgcgccggcgagctc
atgcgcgactccttggcccacgtggccatgggtgccgacgccatcaacttcttccaatgg
agacaatccgcatcgggtgccgaggcgttccactccgcgatggtgccccacgcgggctcc
gatacgaaactgtttcgaggagtgtgcgaactcggcgccgcgctgaagacgctgtccgac
gcgggtgtgcaagacacggaactgaagcgcgcggacacggcgattctgtttagtgcggaa
tccgaatgggccactcgctccgagaccctgcccagcatgaaactcaatcactggcatgac
gtacgcgactggtatcgcggatatctcgatgccggagcgcgcgcggacgtggtcccgctc
gcctacgattggagcggctaccagactatcgtgctgcccaccgtgatcgccctgtccgac
gaggatacccgtcgcatcgcggacttcgccgaaaacggcggtacggtcatcgtcggctat
gccaccggcctgatcgacgaacacttccacatcggtctcggcggataccccggcgccggc
aacggacttctgcgcgacatgctcggcatccgctccgaagaattcaacatcctcggagaa
gaagccgaagacgaaccggccgaaatcggtttgtcgaatggactcacgacccgtctgtgg
cagaatgacgtgacctcggtcgctccagacacttgcgtgcttgccacgtacgtgggtaca
gccgctgctgattgggagctcgacggcgtccccgccatcaccagccgcacctatggcaac
ggtaccgccatctacgtggggtgcgaccttggccgccacgacattgcccgcctgcttaag
gagttcggctcctgctggcgggagctgtcggcgcagccgactgagggtggtcaaactcca
acctatcccaccacagatccccgcatcctgcacaccatccgccgatccgcagatggctcc
actcgcttcgatttctacctcaaccgctcaaaccagcccgttgccgtcaacggcattgag
ggagaaccaatcatcgcctaccgttgcgaggccgacaccaccggctatacgctgaaccgc
aacgccattcttatcgctaaaacgtcctgctaa

DBGET integrated database retrieval system