KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02577Help
Entry
BLNIAS_02577      CDS       T01845                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00010  Glycolysis / Gluconeogenesis
blk01100  Metabolic pathways
blk01110  Biosynthesis of secondary metabolites
blk01120  Microbial metabolism in diverse environments
blk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLNIAS_02577
Enzymes [BR:blk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     BLNIAS_02577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF11
Motif
Other DBs
NCBI-ProteinID: AEI98302
UniProt: F8AU35
Position
complement(2066284..2067159)
Genome map
AA seq 291 aa AA seqDB search
MDNDVNLRTLVNDGGSAVISDYGAHLLRWAPAGQPDVVWTPSTWRIEPGKPLGGGVPICF
PWFGPGFAHGRQLAITPSHGFARVRRWTLDEEGFTDDRVRYVMDSERLTDGEVPWLDDEP
EARFRATYDVHAADTLTMSLTVVNTGDVPMSYEAALHSYLHVGDVSDAGLVGLRGATYLD
ATETGFPPRLQEPEAVTFGERPVDRVYYSDSSVQLRDAVLGRVVYIVKSGSPQTVVWNPG
KEGDHMRCARPGEWRGFVAVEAAACRDRGVTLAPGESHTLSQTLSVETLDV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgatgtcaatctgcgcacgcttgtcaacgatggcggcagcgcggtaatcagc
gattacggagcgcatctgctgcgctgggccccggcaggacagccggatgtggtgtggacg
ccgagcacatggcgcatcgaacctggcaagccgctcggcggcggggttccgatctgcttt
ccgtggttcgggcccggattcgcgcatggccggcagctggcgattacgccatcccacgga
ttcgcaagggtgcgccggtggacgctggatgaggaggggttcaccgatgaccgggtgcgg
tatgtgatggattccgagcgtctgacggatggcgaagtgccgtggcttgacgacgagccg
gaggcgcgcttccgcgccacatacgacgtgcatgccgctgacacgctgacgatgagcctg
accgtcgtcaataccggtgatgttccgatgtcgtatgaggccgcgctgcattcctatctg
catgtgggagatgtatccgacgccggtctggtgggtctgcggggggcgacgtatctggat
gccaccgagaccggtttcccgccgcgattgcaggagccggaggcggtgacgttcggcgaa
cggccggtggatcgcgtgtattattcggattcgtccgtgcagttgcgcgacgccgttctg
ggccgcgtggtgtatatcgtcaaatccggctcgccgcagaccgtggtatggaacccgggc
aaggaaggggaccatatgcgttgcgccagaccgggcgaatggcgtggttttgtggcggtg
gaggcggcggcatgccgcgaccgcggtgtgacgttggcgccgggggagtcgcatacgctt
tcccagacgttgtcggtggagacgcttgacgtgtga

DBGET integrated database retrieval system