KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02655Help
Entry
BLNIAS_02655      CDS       T01845                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2132233..2134470
Genome map
AA seq 745 aa AA seqDB search
MTDAYGNDAATSTGTIADTTNNAASGAPQRAESTERLARPLIKLAKACGLATSFIDQLGT
YTEISDAALVAVLNALDVDASSDEAIARSMTQLEVENSKRLLPSTIVATTGKPTGITLNC
SSDADITVSIELEDGTAFDHFALLPHLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPVPKAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKRLLADAAEKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATLPADVRAQVDALHDSVAARN
DESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFNPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGARNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRAPKDYRKQALASVT
THDLPPTAGYLNFAHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSREYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcatacggcaacgacgcagcaaccagcaccggcaccatcgcagacaccacc
aacaacgccgcttccggtgccccgcagcgcgcggaaagcacggaacgactcgcccgcccg
ctcatcaagctcgccaaagcctgcggacttgccacctcattcatcgaccagctcggcacc
tacaccgaaatcagcgacgcggccttggtcgccgtactcaacgccctcgacgtggacgca
tccagcgacgaggccatcgcacgctccatgacccaacttgaggtggaaaacagcaaacgt
ttgctcccctccaccatcgtcgccaccaccggcaaaccgaccggcatcaccctgaactgt
tcgtcggacgcggacatcaccgtctccatcgagctggaggacggcaccgcgtttgaccac
tttgccctgctgccgcacctcaattccggcaagccggacttgaccatcgctcccgatctg
ccgatgggctaccacacactgaccgtcacggttgacgggcgcgagggcaaggcggccatc
atcgccgcccccgcgcgcattcccgtgccgaaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtcccgcgaatcgtggggcatcggcgattacggc
gatctgaagcgtcttttggcggatgccgccgagaagtccaaggccgacttcatgctcatc
aatccgattcacgccggtgcgccgattccgccgcttgagccatcgccgtatctaccggaa
tcgcgccgattcctcaacgtgacgtacatccggccgcaggatatccccgaatatgccaca
ctgccggccgacgtgcgcgcgcaggtggatgcgctgcatgattcggtggccgcgcgcaac
gacgaatcgaccccgatggacatcaacgcggcgtgggaggccaagcgcccggcgctgcgc
ctgatcttcgaagcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccggacctcgattccttcgccacatggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgctggctgcagtggatcgct
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacgctggggctg
atgcaggacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctcaggtggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccgccgttcaacccgcgctacctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcttgttccgcctgtggtggattccgcaggggctcggtgcccgcaacggcgcatac
gtgacgtacaaccacgaggcgatgttgggagtactggccatcgaggccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtaccggattacgtgcgccgcattctggcc
gatcacggcgtgctcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgtgcacccaaggactatcgcaaacaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgcacacgtcaagctgcgcgag
gagctgcatctcctgagcgagccggtggaggcattcgccgcctcggcgatggccgagcgc
acggccatgatgaaccgtctggtggagaacggctatatctcgcagaccgtggcggatgat
gtggaaggccatgtgcaggaaatcgtggaagcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgctggtggacggcgtgggcgaatgccgctcccagaatcag
ccgggcacttccagagagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtacataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system