KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02670Help
Entry
BLNIAS_02670      CDS       T01845                                 

Gene name
spl
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLNIAS_02670 (spl)
Enzymes [BR:blk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BLNIAS_02670 (spl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2145481..2147007)
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLITYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDERLGSWDDVAELSKTHNIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDEGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEASTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRRTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFDGEFSYEVDGDTSITFRWTAADGTSTAALTFEPGRGLGTDNTTP
VASLAWSDAAGDHETRDLLANPPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcaactcatcacatacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccataccaaa
gtcgacgaacgtctcggcagctgggacgacgtcgccgaactctccaagacccacaacatc
atggtcgacgccatcgtcaaccacatgagttgggaatccaagcagttccaagatgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtgttcccg
aacggcgccaccgaagaggacctggccggcatctaccgtccgcgtccgggcctgccgttc
acccactacaagttcgccggcaagacgcgcttggtctgggtgagcttcaccccgcagcag
gttgatattgacaccgattccgacgagggctgggaatacctcatgtcgattttcgaccag
atggccgcctctcacgtcagctacatccgcctcgacgccgtcggctatggcgccaaggaa
gccagcaccagctgcttcatgactccgaagacgttcaagctcatctcccgcctacgcgag
gaaggcgtcaagcgaggcctcgaaattctcattgaggtgcatagctactacaagaagcag
gttgaaatcgcctccaaggtggaccgcgtctacgacttcgccctgcctccgctgctcctg
cactcgctgttcaccggtcacgtggaacccgtggtccactggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgatggcatcggcgtgatcgacatcggctccgac
cagctcgaccgctccctcaagggcctcgtgcccgacgaggacgtcgacaacctggtcaac
accatccatgccaacacccacggcgaatcccaggccgccaccggtgccgccgcgtccaac
ctcgacctctaccaggtcaactccacgtactactcggccctcggctgcaacgaccagcac
tacttggccgcccgcgccgtgcagttcttcctgccgggcgtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgccgcaccaacaacggccgcgac
atcaaccgccactactactccaccgccgaaatcgatgaaaacctcgaacgcccggtggtc
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcgatggcgagttc
agctacgaggtcgatggcgacacgtccatcaccttccgctggaccgccgccgacggcacg
tccacggccgccctcaccttcgagcccggacgcggcctcggcacagacaacaccaccccg
gttgccagccttgcctggagcgatgccgccggcgaccacgaaacccgcgatctgctcgcc
aacccgccgattgccgatatcgactaa

DBGET integrated database retrieval system