KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02737Help
Entry
BLNIAS_02737      CDS       T01845                                 

Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLNIAS_02737
Enzymes [BR:blk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BLNIAS_02737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2197421..2198521)
Genome map
AA seq 366 aa AA seqDB search
MGAMQVTMIDENKYAETMTDVVLPALEQCCEEGWFDPSAAERSAGIEPLSGIMDTGGRSG
QLHYLCYDSAKFDAIREQGATATFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEH
RGHGKSARDVDNRCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAV
LERYPTLFDKAVLSAPMIAPATGMPLGVARVLVGALCGLGFGKKRVFGQSGFTPEFSMEG
NEGASEARERWYFKLRCENSEYQTYCAAFEWVRQALKLNRAILNPSACAEVETPVLLFQS
GRDIWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPM
IACAAY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatgcaggtgacgatgatcgacgaaaacaagtacgccgaaacgatgaccgac
gtggtgctgcccgcgctcgaacaatgctgcgaggagggctggttcgatccgtccgccgcc
gaacgttcggccgggatcgagccgctgtccggcattatggacaccggcggccgctcgggc
cagctgcactacctgtgctacgactccgccaaattcgacgcgattcgcgagcaaggcgcc
accgccaccttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgagaaa
tacgacgagctcgtctggtattttctgctcgccggctactcggtgtgtgtactcgagcat
cgcggccacggcaagtccgcgcgcgacgtggacaaccgctgcatggtgtggattgatgac
tggcagcgctacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcg
gccggcatgccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccgtg
ttggagcgataccccaccctgttcgacaaagcggtgctctccgccccgatgatcgccccc
gccaccggcatgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggc
ttcggcaagaagcgcgtgttcgggcagtcgggcttcacgccggaattctcgatggaaggc
aacgagggcgcttccgaagcgcgtgaacgctggtacttcaagctgcgttgcgagaatagc
gaataccagacctactgcgcggcgttcgaatgggtgcgccaagcgttgaagctcaaccgg
gccatactgaatccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtcc
ggacgcgacatctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggac
ggcggcggcgaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatg
cccaacagcacttacaagccctacctcgaaaagatcctcggcttctacgacgaccccatg
attgcctgcgccgcgtactga

DBGET integrated database retrieval system