KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02814Help
Entry
BLNIAS_02814      CDS       T01845                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:blk00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:blk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2258259..2259845)
Genome map
AA seq 528 aa AA seqDB search
MNAGTILYIPVAQAEGGATVTVKGQLYGPTLKLDGTDIATGTAVTIATDSTRYVPLSVEG
TGSLYLTGIAIDYAAGSPAATSHTVTVGPNGQYRTIQAALDANDSSETDRLVLKITPGDY
REKITVTKPGVTFANADVTAKRAVTIRASYYSSNTFDADGKFVPQDEFDLGTNKCATVTI
GAGATGFSAYGITFQNDYNVVDHTAAGEQTPAVALNTQADKVYLKNSRIIGRQDTLYVQG
AGNRVYVDGGYIEGTVDFVFGDANAYFAGTELHMAAFAGKNNGYFTAANTKKSGVGLVFD
RCNLTVAAAYDDDAKLSLGRPWQTFAQYTQVRKGDGSSYVTGVDLGTKNSAYTDTSSAVT
YLDSTMSSKITKNRWNVWTSKNQSGKSVDVTFHDDVRFAEYASHDETGALLDPADYKNVV
LGSMSALDEAQVQAKRAELLAALGFGSAAGQWVVPDGAWPFAYDPNYSTGTDVQPTQPGG
NASPNADSAAKADTMPETGSAIIAVVVVAVPLLVAGLALVAVRRNRQQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgctggaaccatcctgtacattccggtcgcacaggccgagggcggcgctacagtc
accgtgaagggccagctgtacggtcctacgctcaagctcgacggtacggacatcgccacc
ggcactgctgtaaccatcgcaaccgacagcacgcgctacgtgccgctctccgttgaaggc
acgggcagcctgtacctgaccggcatcgccatcgactacgcggccggctcccccgccgcc
accagccacacggtcaccgtgggcccgaacggccagtaccggaccattcaagccgctctg
gatgctaacgactcttccgaaaccgaccgactagtgctgaagatcactccgggcgactat
cgcgagaagatcaccgtgaccaagccgggcgtcaccttcgccaacgccgacgtgaccgcc
aagcgcgcggtgacgattcgcgccagctactattcgtccaacacattcgatgccgacggc
aagtttgtgccgcaggatgaattcgaccttggcaccaacaagtgcgccaccgtgaccatt
ggcgcgggtgccacaggtttctccgcctacggcatcaccttccagaacgattacaacgtg
gtggatcacacggcggcgggcgagcagacgccggccgtggcgctgaacacccaggcagac
aaggtgtacctgaagaacagccgcatcatcggccgtcaggacactctgtacgtgcagggc
gccggcaaccgcgtgtacgtggacggcggctacatcgaaggcacggttgatttcgtgttc
ggcgacgccaacgcctacttcgccggcaccgagctgcacatggccgcgttcgccggcaag
aacaacggctacttcaccgccgccaacaccaagaagtccggcgtgggcctggtgtttgac
cgctgcaacttgaccgttgccgcagcatatgacgacgatgccaagctttcgctgggccgc
ccgtggcagacgttcgcgcagtacacgcaggtgcgtaagggcgacggcagcagctatgtg
accggcgtggatttgggtacgaagaactcggcgtatacggacacttcctcggccgtgacc
tacctcgacagcacgatgtccagcaagatcaccaagaatcgttggaatgtgtggaccagc
aagaaccagagcggcaaaagcgtggacgtgaccttccacgatgatgtgcgattcgcggaa
tacgccagccacgatgaaaccggcgcgctgcttgatccggctgattataagaacgtcgtg
ctcggctcgatgtctgctttggatgaggctcaggtgcaggcgaagcgtgctgaattgctc
gcggcactgggcttcggctcggcggctggtcagtgggttgtgccggatggcgcgtggcca
ttcgcttacgacccgaactactcgaccggcactgatgtgcagccgactcagccgggcggc
aacgcctcgcctaacgcggattcggcggccaaggccgacaccatgccggaaaccggctcg
gccatcattgcggtggttgtagtcgccgtgccgctgctcgttgctggcttggcgctggta
gcagtgcgccgcaatcgccagcagtga

DBGET integrated database retrieval system