KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_02927Help
Entry
BLNIAS_02927      CDS       T01845                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BLNIAS_02927
  Lipid metabolism
   00561 Glycerolipid metabolism
    BLNIAS_02927
   00600 Sphingolipid metabolism
    BLNIAS_02927
Enzymes [BR:blk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BLNIAS_02927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2354294..2356600
Genome map
AA seq 768 aa AA seqDB search
MAENTSTFTGAAADGTALTAVYLTQPAANVAIGLVFAGSDLPHIVHWGRPLAKPDTLLAA
YDALKPQRVSGALDDTAWPSILPTQAESWIGEQRVVLRRAGVELFPKFTVTNIEAGGVLE
ATLDAVSGESYTDVAGHARAAGPVRVPGVIVTARDEEQGVEVEWHLELLPGGLVRQKATV
TNLFGADAGAPLEIGKIELGFPLPESAGEILTTTGHHLRERSPQRQPLTVGRFEKPQLAG
RPDFDASLLLTAGVPGFSFEHGDAYSVHVGWSGNSVLSAERLPYTTGVIGGGELLFGGEV
TLAGPGEGQNSYDTPWLFGSYGDGLNEIAARFHSYVRSLHPRLFSHGRPVILNTWEAVYF
DHNFDTLKALADRAADSGVERFVVDDGWFGSRRDDTSGLGDWQIAQDVWPDGPKSLKALA
DYVHAKGMEFGLWFEPEMVNPDSDVARNHPDWILSPTAGRLPLQGRTQQVLDLTNPDAFD
YIYGCMDQLVGELGIDYIKWDHNKLVTEPGSRRSGRPAVHAQTLAVYNIFKGLKTAHPGL
EIESCSSGGGRVDLGILEHADRIWVSDCVDPVERADIQRYTSLLVPPAMMGEHVGASPAH
STQRATSQELRMAMAFFGHMGIEWNLLKEPDEALAKLAVWVAEFKKHRDWFAIDTCVHAD
SNDPAVRLDGMVMPNRDAAIYRFTQLTTSQTYPAAPVHLPGLDPERTYRVSPLDPSLDLT
GLTNGQSTLGWWNEEGVVLTGEALQRYGIRPPSLHPQQAVLLKAVALS
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacacctcgactttcaccggtgccgccgctgacggtaccgcactcaccgcc
gtctacctgacccagcccgccgccaatgtggcgatcggtctggtgtttgccggcagcgac
ctgccgcacatcgtccactggggccgcccgctggccaagcccgacaccctgctggccgcc
tatgacgccctgaagccgcagcgcgtgtccggcgcgctcgacgacaccgcttggccgtcc
atcctgcccacccaggccgaaagctggatcggcgagcagcgcgtggtgctgcgccgcgcc
ggcgtcgagctcttccccaagttcaccgtgaccaatatcgaggccggcggcgtgctggaa
gccaccctcgatgccgtgtccggcgaaagctacaccgatgtggccggccatgcccgtgcc
gccggtccggtccgcgtgcccggcgtcatagtcaccgcgcgcgatgaggagcagggcgtg
gaagtcgaatggcacctcgaactgctccccggcggcctggtccgtcagaaggccaccgta
accaacctgttcggtgcagacgccggagccccgctcgagatcggcaagatcgagctcggc
ttcccgctgcccgaatccgccggcgaaatcctcaccaccaccggtcaccatctacgtgaa
cgcagtccgcagcgccagccgctgaccgtcggccgtttcgaaaagccgcagctcgccggc
cgccctgacttcgacgcatccctgctcctgaccgccggcgtgcccggtttcagcttcgag
catggcgacgcctattcggtgcacgtgggctggagcggcaactccgtgctgtccgccgaa
cgtctgccctacacgaccggcgtaatcggcggcggcgaactcctgttcggcggcgaagtg
acgctcgccggccccggcgaaggccagaactcctacgacaccccgtggctgttcggctcc
tatggcgatggtctcaatgagatcgccgcccgcttccactcctacgtgcgctccctgcat
ccgcgcctgttctcgcacggccgtccggtgatcctcaacacgtgggaagccgtgtacttc
gaccacaacttcgatacgctgaaggcactcgccgacagggccgccgactccggcgtggaa
cgattcgtggtggatgacggttggttcggctcccgccgcgacgacacctccggcctcggt
gactggcagattgcgcaggacgtctggcccgatggtccgaagtcactgaaggcgctcgcc
gactacgtgcacgccaagggtatggaattcggcttgtggttcgagccggaaatggtcaac
cccgattccgatgtggcccgtaaccaccctgattggattctctcgcccaccgctggccga
ctgccgctgcagggccgcactcagcaggtgctcgatctgaccaatccggatgcgttcgac
tacatctacggctgcatggaccagcttgtcggcgagcttggtatcgactacatcaagtgg
gaccacaacaagctcgtcaccgagcccggttcccgccgctccggccgcccggccgtgcac
gcgcagacccttgccgtctacaacatcttcaagggcctcaagaccgcgcatccgggcctt
gagatcgaaagctgctcctctggtggcggccgcgtggatcttggcatcctggagcacgcc
gatcgtatctgggtctccgactgcgtggacccggtcgagcgcgcggacatccagcgctac
acctcgctgctggtgccgccggcgatgatgggcgagcacgtgggcgccagccccgcacac
tccacccagcgcgccaccagccaggaactgcgcatggccatggcgttcttcggtcacatg
ggcatcgaatggaacctgttgaaggagccggacgaggcgctcgccaagctggccgtgtgg
gtggccgaattcaagaagcaccgcgactggttcgccatcgacacctgtgtgcacgccgac
tccaacgatccggccgtgcgcttggatggcatggtgatgccgaaccgtgacgccgccatc
taccgcttcacccagctgaccaccagccagacctatccggccgcgcccgtgcatctgccc
ggacttgaccccgagcgcacctaccgtgtcagcccgcttgacccgagcttggatttgacc
ggtctgaccaacggccagagcactctcggctggtggaacgaggaaggcgtagtcctgacc
ggcgaagccctgcagcgctacggcattcgtcccccgtccctccacccccagcaggcagta
ttgctcaaggctgtggcgttaagctga

DBGET integrated database retrieval system