KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0024Help
Entry
BLJ_0024          CDS       T01240                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K21397  ABC transport system ATP-binding/permease protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Transporters [BR:bll02000]
 ABC Transporters, Eukaryotic Type
  Other subfamilies
   Other ABC transporters
    BLJ_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA ABC_tran Yop-YscD_cpl ABC2_membrane ABC2_membrane_3 AAA_21 SMC_N AAA_22 AAA_29 RsgA_GTPase AAA_25 AAA_18 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADG99521
UniProt: D6ZX75
Position
complement(28611..31274)
Genome map
AA seq 887 aa AA seqDB search
MPPALTIHYGSATYAPNPARTTTIGRAPDCDLVIHNPYVSHHHARVTFTDDGWLLEDTGS
ANGLSINGIHTTSVLLLNSTKVTLAQGATIVCIVGTSGPSTPAQPPRRPAANVAQPALPP
APSAQPAQPTQLAPQQARPVVQPTPPAPQPAQPVQPQPTPAPLAPHRVSPALAHLQQQPR
PTAVAPTAVSPVPVSPASPSPSPCASTSPSNAAGTVLAGSTQAVRLESQLTTNRVHGSFS
PEHDTTGVIGRDTACLIRINDYLVSRKHCSLETTSSGILLTDLNSANGTYVNGRRVAKIW
LREDDVVTVGNTDLIVHEGVLCDRTPFVSNDAVIAENIGLTVGKGTRLLDGINAVFAKGT
LTAVIGPSGAGKSTFTSIVAGLNSPTDGRVLFDGYDVHQNIELLRSRIGFVPQDDVVHRK
LSVDAALEYAAKLRLPGSTKAERAEIIDNVLNELELTSRRKNRIDRLSGGQRKRVSTAIE
LLTEPELLILDEPTSGLDPALDLTVMTMLRQLADAGRVVIVVTHSLSYINKLCDNVLMLA
PGGHPAFFGTVQEMSQAFNGKEWADIFNDVAESPERVYSITDSCQRTMQAESTITRHTEH
EKPAKPFRIKQTITLVIRQLHLIIADPGLLIFLLLLPLLLGLLSLVVPGSHGLGEPDFKD
AATEPNQLLVLVILGACFMGSALSVRDIVSERAIYGRERAVGLSPTSYTASKLIVMGLQT
LLQAAILTTAVSLGKPGPDHGVVTDSGIPELVLAIWLTAWTSALLGEVGSALVKSGEQTM
PLLVVLVMAQLVFSGGMIPVTGRDSLELVSMIFPGRWGFSAAASDIGLNDLLYGPTKVPM
FKKDDLWEHTTDQFWFNIGILGIMVVVFTIVLRICVSNAVAKMRRRS
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgccacctgcccttactattcactacggatccgccacctatgcccccaatcctgcacgt
accacgaccatcgggcgtgcgccggattgcgatctggtgattcacaacccgtacgtatct
caccatcatgctcgcgtcacctttaccgacgatggttggctcttggaagacacgggtagt
gcaaacggactgtccatcaacggcattcacaccacttccgtactgctgctgaacagcacc
aaagtgacgctggcacaaggtgccaccatcgtctgcatcgtcggaaccagcgggccgtcc
acgccggcacagcccccgcgacgccctgcggcaaacgtggcccagcctgcgctaccgccg
gcaccatcagcgcaaccggcacaacccacgcaactcgcgccgcaacaggcacgcccagta
gtgcaacccacaccaccagcaccgcaaccggcacaaccggtacaaccgcaaccaacgcca
gccccgctggccccgcaccgcgtatccccggccctcgcgcacctgcaacagcaaccccgc
ccaacagcagtggcaccgacggcagtatcgccagtgccggtatcacccgcatcaccatct
ccgtctccctgcgcatccacttccccatcgaatgccgccggcaccgttctggcaggcagc
acgcaagcggtaaggctcgaatcccaactcaccaccaaccgcgtgcacgggtccttcagc
cccgagcacgacaccacaggcgtcatcggccgcgataccgcctgcctgattcgcatcaac
gattatctggtctcccgcaaacactgctcgctggaaaccaccagcagcggcatcctgctc
actgacctgaactccgccaacggcacttacgtcaacggccgccgcgtcgcgaagatctgg
ctgcgggaagacgacgtcgtcaccgtcggcaacaccgacctgatcgtgcatgaaggcgtg
ctgtgcgaccgcacgccgtttgtcagcaacgacgcggttatcgccgaaaacatcggactg
accgtgggcaaaggcacccggctgcttgacggcatcaacgccgtattcgccaagggcacg
ctcaccgccgtaatcggaccttccggcgccggcaaatcaacattcacctccatcgtcgcc
gggctcaacagccccacggacgggcgcgtgctgtttgatggatacgacgtgcatcagaac
atcgaactgttgcgcagccgtatcggattcgtgccgcaggacgacgtggtgcaccgcaag
ctctctgtggacgcggcgctcgaatacgccgccaagctgcgcctgcccggctcaaccaag
gccgagcgcgccgaaatcatcgacaacgtgctcaatgagctggaactcacgtctcgccgt
aagaatcgcattgacagactgtccggcggccaacgcaagcgcgtgtccaccgctatcgag
ctactcaccgaacccgaactgctgattctcgacgaaccgacctcgggcctcgacccggcg
ctggatcttacggtgatgaccatgttgcgccaactggcggatgccggccgcgtggttatc
gtggtcacccattcactgtcgtatatcaacaagttgtgcgataacgtgctcatgctcgct
cccggcggccatccggcattcttcggcaccgtgcaggagatgagccaggcgttcaacggc
aaggaatgggccgacatcttcaacgatgtcgccgaatctccggaacgggtgtattcgatt
actgattcatgccagcgcaccatgcaggccgagtccaccatcacgcggcacaccgagcat
gagaaaccggcaaagccattccgcatcaaacagaccatcactctggtgattcgtcagctg
catttgatcatcgccgaccccggattgctgatcttcctgctgttgctgccattgctccta
ggactgctgtcgctggttgtgcccggttctcatggcttgggtgagcccgatttcaaagac
gccgccaccgagccgaaccagctgcttgtgctcgtcatactgggtgcctgttttatggga
tcggctttgtccgtgcgagacatcgtctccgagcgagcgatttacggccgcgagcgcgcg
gtgggtttgtcgcccacgtcatacaccgcctcgaaactcatcgtgatgggtttgcagacc
ttgttgcaggcggcgattctgaccactgcggtcagcctcggcaagcccggcccggaccat
ggtgtggtcactgattccggcatacccgaactggtgttggcgatttggctgactgcgtgg
acttccgcattgttgggcgaagtcggctcggcgttggtgaagtcgggagaacagacgatg
ccattgctggtggtgctggtcatggcccagttggtgttctccggcggcatgattccggtc
accggccgcgacagcctcgagctggtcagcatgatcttccccggacgttggggcttctcc
gccgccgcctcggatatcgggctcaacgatctgctgtatggccccaccaaggtgccgatg
ttcaaaaaggatgatctgtgggagcacaccacggatcagttctggttcaacattggcatt
ctggggattatggtagtcgtcttcaccattgtgctgcgtatttgcgtcagcaatgccgtg
gccaagatgcgtcggcgctcatag

DBGET integrated database retrieval system