KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0028Help
Entry
BLJ_0028          CDS       T01240                                 

Definition
(GenBank) major facilitator superfamily MFS_1
  KO
K08177  MFS transporter, OFA family, oxalate/formate antiporter
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Transporters [BR:bll02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Oxalate:formate antiporter (OFA) family [TC:2.A.1.11]
    BLJ_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF986
Motif
Other DBs
NCBI-ProteinID: ADG99525
UniProt: D6ZX79
Position
complement(35087..36442)
Genome map
AA seq 451 aa AA seqDB search
MGDTTLVRVGRSSYTSYERIRPYMARFTENRWTSAIIPALLIHIPIGTVYCWSVFKQLIA
DRLHASPASVEWGFSLAIFFLGMSAAFAGPMVEKNIKKSALVSMVCFVVGFAGTGVSIAL
NFLPGVFICYGAIMGIGLGVGYLTPVKNLMLWFADNKGLATGIAVAGFGLAKAIASPLME
YLIGTVGLVSMFFILAAVYAVMMFVGFLLIKRPAGWVYDPATSHVSRKTILKKPVFWGIW
IAFYINITCGLALISQEKDILHDVLKAFPQYANLSPAKFAAAISGIIGLVLAVDSVFNTA
GRVGFSTLSDHLKRRETVYQVIFIMSIAVCLLQIFTNSIDNALLWAVLAMLFLVNAGYGG
GFSTLPVLLDQHFGTKTVSTTHGLTLSAWAFAGLSGNQLASFVVAHAPDQAHRYAALIPV
LTGLFVVALISISLVKYLGDRNVTKAVEDRG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggcgatacgactctcgttcgggtcggcaggtcatcgtacaccagttacgaaaggatc
cgtccatatatggcaaggtttaccgagaatcgttggaccagcgcgattattcccgcactg
ctgattcatatcccaatcggtaccgtctattgctggagcgtgttcaagcagcttatcgct
gaccgtctccacgccagccccgcctccgtggaatggggcttctcactcgccatcttcttc
ctcggcatgtccgccgcgtttgccgggccaatggtggagaaaaacatcaagaaatccgca
ctcgtctccatggtctgcttcgtggtcggcttcgccggcacgggcgtgagcatcgccctg
aacttcctgccgggcgtgttcatctgttatggcgcgatcatgggcatcggcctgggcgtc
ggttatctgactccggtcaagaacctgatgctttggttcgccgacaacaagggcctcgcc
accggcatcgccgtcgccggcttcggcctggccaaggccattgccagcccactgatggaa
tatctcatcggcacggttggcctggtcagcatgttcttcatcctcgccgcggtctacgcg
gtgatgatgttcgtcggcttcctgctcatcaagcgtccggccggctgggtgtacgatccc
gcgacctcacacgtcagccgcaagacaatcctcaagaagcccgtgttctggggcatctgg
atagccttctatatcaacatcacctgcggcctggccctcatcagccaagagaaggacatc
ctgcacgatgtgctcaaggccttcccgcagtatgccaacctgagccccgccaagtttgcc
gccgccatctccggcatcatcggactggtgctcgccgtggactccgtgttcaacacggct
ggccgcgtgggcttctccacactctccgaccacctgaagcgccgcgagaccgtctatcag
gtaatcttcatcatgtcgattgccgtgtgcttgctgcagatcttcaccaacagcatcgac
aacgctctgctgtgggccgtgctggccatgctgttcctcgtcaacgcgggctatggtggc
ggtttctcgacgctgcccgtgctgcttgatcagcacttcggcaccaaaaccgtctccacc
acgcacggtctgacgctgagcgcctgggcgttcgccggtctgtccggcaaccagttggcc
tcgttcgtagttgcccatgcgcctgatcaggcccaccgctacgccgcactcatcccggtg
ctcaccggcctgttcgttgtggccctgatcagcatcagcctggtcaagtacctcggcgac
agaaacgtcacgaaggccgtcgaagaccgaggctga

DBGET integrated database retrieval system