KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0036Help
Entry
BLJ_0036          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(50550..51536)
Genome map
AA seq 328 aa AA seqDB search
MGSSTALTELTMQKYQRMQTCADVQRRSAWRPPYALTTALELLSIEVPRISSKHRGLATT
TIVAVPHANDKRHIVGVKVVVWPFPLDTVIIEGQFTCTSPACTWAMFSAYLELEELIVLA
DSMMRRDRRLCRTTIDALSLYLDEAEAQVRANKENGANSYLFRGYNKCRRALLLARAGTD
SSMETRTRLVLLKYGLDCPQVNYPIFVGNNTRPIYLDLAYPEFKVCIEYEGSHHAGQWLN
DARRRQMIEDAGWKYIQVTKLDIGNEAGEEALARRVAERIQEVTGKTVQLTMRQTTQQIS
DVRKLRRIPLYKRLKFEPLLPIIPTTQE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctcaacggcattgaccgagctgacaatgcagaagtatcaacgaatgcagacg
tgcgcagatgttcaacgacgaagcgcatggcgcccaccctatgccctgacaacagcgttg
gagcttttgtcaattgaagtaccccgcatatcaagcaaacacagaggccttgcaactaca
accattgttgcggttccacacgccaatgacaaacggcacattgtgggggtcaaagtggtt
gtatggccttttccactagacacggtcataatcgagggacaattcacatgcacttcacca
gcttgcacatgggccatgttctccgcgtatctcgaacttgaagaactcatcgttctcgct
gattccatgatgcgacgagatcgaaggctctgcagaacaaccatcgacgccctttctctg
tatctcgatgaggccgaggcccaggtgcgagccaacaaagagaatggagccaattcgtat
ttgttccgcgggtataacaaatgccgtcgcgccctgcttttggcgcgcgcgggcacagat
tcctccatggaaacacgaactcgtttggttctcttgaaatacggtctggattgcccgcag
gtgaattatccaatattcgtaggaaacaacaccagacccatatatctcgatcttgcatac
cctgaattcaaggtatgcatcgaatacgaaggctctcatcatgccgggcaatggctgaat
gacgcgagacgccgccagatgatcgaagacgctggctggaagtacattcaagtcaccaaa
ttagatattggcaacgaagcgggagaagaggcccttgcccgaagagttgccgaaaggata
caggaggttacgggcaaaacggtccagctcacgatgcggcaaaccacccagcaaattagc
gatgtccgaaagctacgccgtattccgctgtacaaacggctgaaattcgagcctctgctg
ccaattattccgacgacgcaggaataa

DBGET integrated database retrieval system