KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0040Help
Entry
BLJ_0040          CDS       T01240                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Response_reg HTH_40 Sigma70_r4_2 Sigma70_r4 HTH_10 HTH_38 HTH_23 HTH_28 HTH_20 HTH_5
Motif
Other DBs
NCBI-ProteinID: ADG99536
UniProt: D6ZX90
Position
55443..56114
Genome map
AA seq 223 aa AA seqDB search
MPDISGQDGPKPTMLIMDNDRMALMALQSILSKALPDFELLPPVSEGSKAIQLCTATKHP
PAVLLADIAMNDINGPDVVRAIRRENATTAILAITASIVGRHAQEMARAGAQGIMSKNDD
VRLQAVAIRQVQTGKIWGDGGDVRFETAAVASARIKAEKDNRLSAREMEVAELWSRGRTM
PQIAAELSITETTVRTHLMRAADKLGAGNLKELIGAWIRMNLH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgccggatatcagcgggcaggatgggccaaagcccaccatgctcatcatggacaacgac
cgcatggccctgatggcattacagtcgattttgtcgaaggccctgccagacttcgaattg
ttgccgccggtgagcgaaggcagcaaagccattcagctgtgcacggccaccaaacacccg
cctgctgtgctattggccgatatcgcgatgaacgacatcaatggtccggatgtggtgcgt
gcaatccgcagggaaaacgcgaccacggcgatactggccattaccgcctcgattgtgggc
cgacatgcccaggagatggcccgggccggcgcacagggcatcatgagcaagaacgatgat
gtgcgattgcaggccgtggcgattcgtcaggtgcagaccggcaaaatatggggcgatggt
ggcgacgtgcggttcgagaccgcggccgttgcgtccgcgcgcatcaaggccgagaaggac
aaccgtctgagcgcgcgtgagatggaggttgcggaactgtggtcccgcggccggaccatg
ccgcagatcgccgccgaactgtccatcaccgaaaccaccgtgcgcacgcatctgatgcgt
gcggccgacaagctcggcgccggcaatctcaaggaacttatcggcgcatggattcgcatg
aacctgcactga

DBGET integrated database retrieval system