KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0041Help
Entry
BLJ_0041          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4381 Phage_holin_3_6 HisKA_3 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ADG99537
UniProt: D6ZX91
Position
56182..57333
Genome map
AA seq 383 aa AA seqDB search
MKRPIIISRHSSYSYGHADGKKHHQIDIDIELNHPLAMFGPIGVLAVAAIVYAVTGSWLV
TASAALTASVLLVLLGIALRWRKRVVNQENENEQMESALADLRHGNQLAIELHDTLSNDL
TYISTIARNNLAAPAGIDGGDWQRVLDRSQRAFAEVHGIIDFLTEQSGMDAGFRDESLPV
GGTGTSEVATAESGQVDSPTKESALARDPVGAGSCPAIANEVVDNAVPENAGGDDRTQST
AGMPQSFVTRVKAQITDTEEFLEAQGYRGTAAVNGIVMVVDPEAAAEALSLMTEIGTNIR
RHAPAGDDSYLLFVTLSPEWIEIRETNDIRDDADAQNGLSAQERSGRGLAMHRTRVQELG
GELTTRSDDGTWMIYVRIPCVRG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtccgattatcatttcgcggcattcgtcgtattcgtatggtcacgccgacggc
aagaagcatcatcagattgatatcgatatagaactcaatcatccgctggcgatgttcggc
ccgatcggtgtgcttgcggtggcggccatcgtctatgcggtgaccgggtcgtggctggtc
acggcgtcggcggcgttgacggcaagcgtgctgctggtattactgggcattgcgttgcgc
tggcgcaagcgcgtggtgaatcaggagaacgaaaacgagcagatggaatcggcgctggcc
gatctgcgccacggcaaccagctcgcgatcgaactgcacgacacgctgtccaacgatctg
acgtatatctcgaccatcgcccggaataatctggccgcgccagccggcatcgatggtggc
gactggcagcgcgtgctggatcgcagccaacgtgcctttgcggaagtgcatggcatcatc
gattttctgaccgagcagagcggaatggacgccggcttccgggacgagtccttgccggtc
ggtggcaccgggacatctgaggtggcgactgcagaatcagggcaggttgattcgccgacg
aaagaatccgccctggctcgtgacccggtaggcgccgggagctgtccagcgattgcgaat
gaggtggttgacaatgccgtgcccgagaacgccggtggcgatgaccgtacgcaatccaca
gcgggcatgccgcaatccttcgtcacgcgtgtgaaggcgcagatcaccgataccgaggag
tttctggaggcgcagggctatcgggggacggccgcggtcaacggcatcgtcatggtcgtg
gaccccgaggcggcggccgaggcgctgtcgctgatgacggagatcggcacgaatatccgc
cgccatgcaccggcgggagatgattcctacctgctgttcgtcaccctgtctcccgaatgg
attgagattcgcgagaccaacgatatccgtgacgatgccgacgcgcagaatggcctgtcc
gcgcaggagcggtcggggcgtgggctggccatgcatcgcacccgtgtgcaggagttgggc
ggtgaattgaccacccgttcggatgatggcacgtggatgatctatgtgcgtatcccgtgc
gtgcggggctga

DBGET integrated database retrieval system