KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0054Help
Entry
BLJ_0054          CDS       T01240                                 

Definition
(GenBank) cell cycle protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE CopD
Motif
Other DBs
NCBI-ProteinID: ADG99550
UniProt: D6ZXA4
Position
complement(72045..73706)
Genome map
AA seq 553 aa AA seqDB search
MIATRLRQISLLLIAMAISALAFIQMFQRTAGEFPMQYAGMLALVVVLFLVLWGLIVRFQ
PYASQSILPCVLLLTATGVTMIARIDQSEGWAVAQRQLVWLCIAIVLSALLIIFLKDYRV
LRRFSYVSMVVGLVLLLAPMLPFIGMEVNGARIWIRIPGLGQFQPGEFAKLFLAFFFAAY
LFDHRDQLAVGGKKMLGLQLPRIKDLGPIIVVWIASMGVLVMQHDLGTSLMFFAMFVAML
YTATGRKSWIIIGLIAFAAGAVLAAGMFSHVGQRIDAWLHPFSNEQYNKTPGGSWQLVTG
IFGLASGGMLGTGLGQGHPSLVTFANSDFIYASLGEELGLMGVLAILMLYLLIIASGFIT
AMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTGLTLPYMAAGGSSLIANYILAT
LLIIISNSANAPEPELTSDTFQYEALAVLRNKELEARARATEPIVQPRSASATASQSEAE
SFDDPIVDITKHAPDTLEAPEVPAIVTSAGSAAAPIAEPIVDATTPAYAGADEPYTPTGT
IPPLPPVNGGTRV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctacccgtctacgtcagatttccttgttgctgattgccatggcgatcagcgcg
ttggcgttcatccagatgttccaacgcaccgccggcgaattccctatgcaatacgccggc
atgctggcattggtcgtagtgctgtttctggtgctgtgggggctgattgtgcgcttccag
ccgtacgccagccagtcgattctgccttgcgtgctactgctgaccgccaccggcgtgacc
atgatcgcccgcatcgaccagagcgaaggttgggcggtggcccaacgccagctggtgtgg
ctgtgcatcgccatcgtgctttccgcgctgctcatcatcttcctgaaggactaccgcgtg
ctacgacgcttctcctatgtgtcgatggtggtgggcctggtgctgctgctcgccccgatg
ctgccgttcatcggcatggaggtgaacggcgcgcgcatctggatcaggattccgggattg
ggccagttccagccgggcgagttcgccaaactgttcctcgcgttcttcttcgctgcctac
ctgttcgatcatcgcgaccagctggccgtgggcggtaagaagatgctcggtctgcagctg
ccgcgtatcaaggatctcggcccgatcatcgtggtgtggatcgcctcgatgggcgtgctc
gtcatgcagcatgatctgggcacctcgcttatgttcttcgccatgttcgtggccatgctg
tacacggccaccggccgtaaaagctggatcatcatcggtctgatcgcgttcgccgcgggt
gccgtgctggccgcaggcatgttcagccacgtgggtcagcgcatcgacgcctggctgcac
ccgttcagcaacgagcaatacaacaagacccccggcggctcctggcagctggtcaccggc
attttcggcctggcatcaggcggcatgctcggcaccggtctcggccaaggccatccttcg
ctcgttacgttcgcgaactccgatttcatctacgcctctctgggcgaggaactcggtctg
atgggcgtcctggccattttgatgctctacctgctcatcattgcctccggcttcatcacc
gccatgaaaatcaaggatggcttcggcaagctgctcgcttccggactggtgttcaccatg
gccttccaagtgttcaccgtggtcggcggcatcacgctggtgattcctctgaccggtctg
accctgccctatatggcggccggcggctccagtctgatcgccaactatattctcgcgacc
ctgctcatcatcatctcgaactcggccaatgcgcccgagccggagctgacctcggatacg
ttccagtacgaggctttggccgtgctgcgcaacaaggaacttgaggcccgagcccgcgcc
actgagccgatcgttcagcctcgcagcgcgtcggctacggcgtcgcagtccgaggcggaa
tcgtttgacgaccccattgtggacatcaccaagcacgcgccagacacacttgaggcaccc
gaagtgcccgcaattgtgacctctgcgggctctgctgcggcccccatcgccgagcccatt
gtggatgccaccactccggcgtatgccggcgccgatgaaccgtacacgcctaccggtacg
attcccccgcttcctcccgttaacggaggcactcgcgtatga

DBGET integrated database retrieval system