KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0055Help
Entry
BLJ_0055          CDS       T01240                                 

Definition
(GenBank) protein phosphatase 2C domain protein
  KO
K20074  PPM family protein phosphatase [EC:3.1.3.16]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
Enzymes [BR:bll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     BLJ_0055
Protein phosphatases and associated proteins [BR:bll01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    BLJ_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C_2 PP2C ETRAMP BofC_C OppC_N
Motif
Other DBs
NCBI-ProteinID: ADG99551
UniProt: D6ZXA5
Position
complement(73703..75376)
Genome map
AA seq 557 aa AA seqDB search
MPKSAASQPLFLYSTTVSDVGTVRANNQDSSFAGEHLIAMCDGMGGHAGGDTASSIAIRS
LAHIEQDDTGGNVETISRMMETSVMAAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVI
AHIGDSRAYLLRDGHLSRITCDHSYVQHLINTGRITPSEAKNHPQRNVVMRVLGDFDIDP
RPDISIRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLSDQGECAQRLVQMALRAGSTDN
VTAVIADATLALDADAFDLPHQTPLVGGAASRNLEPIADIVNEPVATAPALREDDSPAQR
AAALIQPASAHETEAAQTTAEPSSTRVVQPSTVREETGERANPDTGEIPVVQKPDGRLSA
DPNDPDVAKAIRDEQIEQKKATRTKKRRNKLAVIITCILAVLALAGAGWGVYTWSQTHYY
VGDSNGTVAIYRGVPTNLFGLELSHEVQTTNIATADLPQTWRDQLSQGITVGSLDEAQSH
VGIIRTEMRKLAKQQEADAAKKAEASNSLDSSKDSSQSDSKDSTKDSSSQSGSSSSSDSS
DKSGIGAADNAATGDSQ
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaatccgccgcttcacaaccgctgttcctgtattccaccacggtgtccgatgtg
ggcactgtgcgcgcgaacaatcaggattcctccttcgccggcgagcatctcatcgccatg
tgcgacggcatgggcggtcacgccggcggcgatacggcatcctccatcgccatccggtca
ctggcccacatcgagcaggacgacaccggcggcaacgtcgagacgatctcccgcatgatg
gaaacctccgttatggccgcgcatgacgccatcgtcggcaaggccaagcgcgaacgcaag
cttgccggcatgggcaccaccgttaccgcagtggcattggtggccggctactgggtcatc
gcccatatcggcgattcgcgcgcctacctgctgcgcgacggacacctgagccgcatcacg
tgcgaccacagctacgtgcaacacctcatcaacaccggtcgtatcaccccgtccgaagcc
aagaaccacccgcagcgcaacgtcgtgatgcgcgtgcttggcgactttgacattgacccg
cgcccggatatttcgattcgccgagcccaccccgccgaccgttggctgctgtgctcggac
ggcctgtgcggtgtgctggaagattccaccatcgaagagacgatgaccacgctgtccgat
cagggcgaatgcgcgcagcgtctggtgcagatggcactgcgggcaggcagcaccgataat
gtcacggccgttattgcggatgccacgttggcgttggatgccgatgcgttcgatctgccg
caccaaacgccgttggtcggcggtgccgccagccgtaatcttgagccgatcgccgacatc
gtcaacgagccggtggctaccgcgcccgcgctgcgtgaggatgattcccccgcccagcgc
gccgcagcattgattcagcccgccagcgcgcacgagacggaggccgcgcaaaccacggcc
gaaccgtcgtccacacgcgtggtgcagccgtccaccgtccgcgaggagaccggtgaacga
gccaatcccgataccggtgagattccggtggtgcaaaagccggatgggcgcctgtccgcc
gaccccaacgacccggatgtggccaaagccatccgcgatgagcagatcgagcagaagaag
gccacgcgcaccaagaagcgccgcaataagcttgcggtgattattacctgcattcttgcc
gtgctggccttggccggcgctggctggggcgtgtacacgtggagccagacgcactactac
gtgggagatagcaacggcaccgtggccatttatcgtggcgtgccgaccaatctctttgga
cttgagctttcgcacgaagtgcagaccaccaatatcgccaccgcggacctgcctcagaca
tggcgtgaccagctgagccaaggcatcacagtcggttcgttggacgaagcgcagtcgcat
gtgggtatcatccgcaccgaaatgcgcaaactggccaagcagcaggaagccgacgccgcc
aagaaggccgaggcgtccaattccctggacagttccaaagacagttcccagagcgattcc
aaggacagcaccaaggattcgtccagccagtccggttcgtcaagctcatctgattcctcg
gataaatccggtatcggagcggccgacaacgcggccacgggggattctcaatga

DBGET integrated database retrieval system