KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0056Help
Entry
BLJ_0056          CDS       T01240                                 

Definition
(GenBank) FHA domain containing protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(75381..75911)
Genome map
AA seq 176 aa AA seqDB search
MTELTFALLKYGFLILLWIFIWLAVRSLRKDIETFSPRPSRARRRREREVHKAKAETPQA
AAPRPHRRPSASASSVASAQPTLLVIIDGPLAGSSVPLAEADIALGRAASNTVVLDDEFV
SSHHARVYRDTRSGQWAIEDLNSTNGTVVNQQRINRPTILPARIPVRIGATTFELR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactgacattcgccctgctcaagtatggattcctgatcctgctgtggatattc
atctggctggccgtgcgttcgctgcgcaaggacatcgagacgttcagtccgcgaccttcg
cgcgcgcgtcgccgtcgtgagcgtgaagtgcataaggccaaggccgaaacgccacaggca
gctgcgccgcgcccgcatcgccggcccagcgcttccgcgtcgtccgtcgcctcggcgcag
cctaccctgttggtcatcatcgatggtccgcttgccggcagctccgtgccgctggccgaa
gccgacatcgcgcttggccgcgccgcctcgaacaccgtggtgctcgatgacgaattcgtg
tcttcccaccatgcccgcgtctaccgtgacacgcgctccgggcagtgggccattgaagac
ctgaactccaccaatggcaccgtggtcaaccagcagcgcatcaaccgccccaccatcctg
cccgctcgtattcctgtgcgcatcggcgccaccaccttcgaactgaggtag

DBGET integrated database retrieval system