KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0059Help
Entry
BLJ_0059          CDS       T01240                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BLJ_0059
Enzymes [BR:bll01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BLJ_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79369..80460
Genome map
AA seq 363 aa AA seqDB search
MQVTMIDENKYAETMADVVLPALEQCREEGWFDPSAAERSAGVEPLSGIMDTGGRSGQLH
YLCYDAARFDAIREQGATAVFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEHRGH
GKSARDVDDHCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAAVLER
YPTLFDKAVLSAPMVAPATGMPLGVARVLVGALCGLGFGKKRVFGQSDFTPEFSMEGNEG
ASEARERWYFKLRCENREYQTYCAAFEWVRQALKLNRAVLNPSACAEVETPVLLFQSGRD
IWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPMIAS
AAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgatgatcgacgagaacaagtacgccgaaacgatggccgacgtggtgctg
cccgcgctcgagcaatgccgcgaggagggctggttcgatccgtccgccgccgaacgttcg
gccggggtcgagccgctgtccggcattatggacaccggcggccgttcgggacagctgcac
tacctgtgctatgacgccgccaggttcgacgcgatccgcgaacaaggcgccaccgccgtc
ttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgagaagtacgacgag
ctcgtctggtacttcctgctcgccggctattcggtgtgcgtgctcgaacatcgcggccac
ggcaagtccgcgcgcgacgtggacgatcattgcatggtgtggattgatgactggcagcgc
tacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcagccggcatg
ccgctgaacctgttctgccattcgatgggcggcggcattggcgcggccgtgttggagcga
taccccaccctgttcgacaaagcggtgctctccgccccgatggtcgcccccgccaccggc
atgccgctgggcgtggcccgtgtgctggtcggcgcgctgtgcggactcggcttcggcaag
aagcgtgtgttcgggcagtcggacttcacgccggagttctcgatggaaggcaacgagggc
gcttccgaggcgcgtgaacgctggtacttcaagctgcgttgcgagaaccgcgaataccag
acctactgcgcggcgttcgaatgggtgcgccaggcgttgaagctcaaccgggccgtgctg
aacccgtccgcctgcgccgaagtggagacgccggtgctgctcttccagtccggacgcgac
atctgggtactcaataagccgcagaatcacttcgtccaactggtcaaggacggcggcggc
gaggcgaacatcgtgcgcttccccgaatcgcgccacgaaatcttctccatgcccaacagc
acctacaagccctacctcgaaaagatcctcggcttctacgacgatcccatgatcgccagc
gccgcgtactga

DBGET integrated database retrieval system